Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3209786 605 12 Q16236(NF2L2_HUMAN) RecName: Full=Nuclear factor erythroid 2-related factor 2 ; Short=NF-E2-related factor 2 ; Short=NFE2-related factor 2 ; Short=Nrf-2 ;AltName: Full=HEBP1;AltName: Full=Nuclear factor, erythroid derived 2, like 2 ;
QUERYSEQ
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQEQLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGH
IESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVGNCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHSVESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDAQCENTPEKELPVSPGHRKTPFTKDKHSSRL
EAHLTRDELRAKALHIPFPVEKIINLPVVDFNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLLKEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q16236(NF2L2_HUMAN)]

605
region name description
1-605 CHAIN /note="Nuclear factor erythroid 2-related factor 2" /id="PRO_0000076449"
497-560 DOMAIN /note="bZIP"
334-449 REGION /note="Disordered"
499-518 REGION /note="Basic motif"
522-529 REGION /note="Leucine-zipper"
571-605 REGION /note="Disordered"
591-596 REGION /note="Mediates interaction with CHD6 and is necessary to activate transcription"
334-371 COMPBIAS /note="Polar residues"
388-420 COMPBIAS /note="Polar residues"
421-449 COMPBIAS /note="Basic and acidic residues"
1-605 DISORDER predicted by DISOPRED

MONOMER
605
pdb_id a1 identity[%]2 description
7x5e B 100.0
3wn7 B 100.0
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.