Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3181392 498 103 Q13568(IRF5_HUMAN) RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ;
QUERYSEQ
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL
QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL
KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q13568(IRF5_HUMAN)]

498
region name description
1-498 CHAIN /note="Interferon regulatory factor 5" /id="PRO_0000154558"
14-122 DNA_BIND /note="IRF tryptophan pentad repeat"
121-207 REGION /note="Disordered"
478-498 REGION /note="Disordered"
169-206 COMPBIAS /note="Pro residues"
1-498 DISORDER predicted by DISOPRED

MONOMER
498
pdb_id a1 identity[%]2 description
3dsh A 99.6
8hcl E 47.7
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.