Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
890647 132 0 Q01629(IFM2_HUMAN) RecName: Full=Interferon-induced transmembrane protein 2 ;AltName: Full=Dispanin subfamily A member 2c; Short=DSPA2c;AltName: Full=Interferon-inducible protein 1-8D;
QUERYSEQ
MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGVPHNPAPPMSTVIHIRSETSVPDHVVWSLFNTLFMNTCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGIFMTILLIIIPVLVVQAQR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q01629(IFM2_HUMAN)]

132
region name description
1-132 CHAIN /note="Interferon-induced transmembrane protein 2" /id="PRO_0000153728"
1-56 TOPO_DOM /note="Cytoplasmic"
78-106 TOPO_DOM /note="Cytoplasmic"
107-127 TRANSMEM /note="Helical"
128-132 TOPO_DOM /note="Extracellular"
70-70 LIPID /note="S-palmitoyl cysteine"
71-71 LIPID /note="S-palmitoyl cysteine"
104-104 LIPID /note="S-palmitoyl cysteine"
1-46 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.