Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4013839 133 0 Q01628(IFM3_HUMAN) RecName: Full=Interferon-induced transmembrane protein 3 ;AltName: Full=Dispanin subfamily A member 2b; Short=DSPA2b;AltName: Full=Interferon-inducible protein 1-8U;
QUERYSEQ
MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q01628(IFM3_HUMAN)]

133
region name description
1-133 CHAIN /note="Interferon-induced transmembrane protein 3" /id="PRO_0000153729"
1-57 TOPO_DOM /note="Cytoplasmic"
79-107 TOPO_DOM /note="Cytoplasmic"
108-128 TRANSMEM /note="Helical"
129-133 TOPO_DOM /note="Extracellular"
60-93 REGION /note="Interaction with SPP1"
108-133 REGION /note="Interaction with VAPA"
71-71 LIPID /note="S-palmitoyl cysteine"
72-72 LIPID /note="S-palmitoyl cysteine"
105-105 LIPID /note="S-palmitoyl cysteine"
1-122 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.