Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4033199 462 460 P68104(EF1A1_HUMAN) RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha-1; EC=3.6.5.- ;AltName: Full=Elongation factor Tu; Short=EF-Tu;AltName: Full=Eukaryotic elongation factor 1 A-1; Short=eEF1A-1;AltName: Full=Leukocyte receptor cluster member 7;
QUERYSEQ
MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLAYTLGVKQLIV
GVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALS
EALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGK
VTKSAQKAQKAK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P68104(EF1A1_HUMAN)]

462
region name description
2-462 CHAIN /note="Elongation factor 1-alpha 1" /id="PRO_0000090885"
5-242 DOMAIN /note="tr-type G"
14-21 REGION /note="G1"
70-74 REGION /note="G2"
91-94 REGION /note="G3"
153-156 REGION /note="G4"
194-196 REGION /note="G5"
14-21 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
153-156 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
194-196 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
1-462 DISORDER predicted by DISOPRED

MONOMER
462
pdb_id a1 identity[%]2 description
5lzs HC 100.0 EF1A1_RABIT Elongation factor 1-alpha 1
6ra9 B 92.6 EF1A2_RABIT Elongation factor 1-alpha 2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4d61[1] Y 40S RIBOSOMAL PROTEIN S23[134 aa] JA 0.0
/40.0
1
/2
ERF3A_HUMAN EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-BINDIN..
5lzs[4] VB uS12[141 aa] HC 100.0
/100.0
2
/2
EF1A1_RABIT Elongation factor 1-alpha 1
5lzt[1] WB uS12[141 aa] IC 0.0
/40.0
4
/4
ERF3A_HUMAN eRF3a
5lzw[4] WB uS12[141 aa] IC 0.0
/40.8
4
/4
HBS1L_HUMAN Hbs1l
8g5z[1] T uS12[142 aa] IC 100.0
/100.0
3
/3
EF1A1_RABIT Elongation factor 1-alpha 1
4v6w[1] WB RL40_DROME 60S ribosomal protein L40[52 aa] A 0.0
/37.2
1
/1
EF2_DROME Elongation factor 2
8g5z[1] AC eL40[52 aa] IC 100.0
/100.0
1
/1
EF1A1_RABIT Elongation factor 1-alpha 1
5lzs[3] U G1T6D1_RABIT uL14[139 aa] HC 100.0
/100.0
5
/5
EF1A1_RABIT Elongation factor 1-alpha 1
5lzt[1] U G1T6D1_RABIT uL14[131 aa] IC 0.0
/40.0
2
/2
ERF3A_HUMAN eRF3a
7zjw[1] CA A0A3P9HH38_ORYLA 60S ribosomal protein L23[139 aa] A 0.0
/25.7
1
/1
SELB_HUMAN eEFSec
6ra9[2] B EF1A2_RABIT Elongation factor 1-alpha 2[458 aa] A 100.0
/92.4
43
/43
EF1A2_RABIT Elongation factor 1-alpha 2
1f60[7] B EF1B_YEAST ELONGATION FACTOR EEF1BA[90 aa] A 95.1
/81.8
41
/41
EF1A_YEAST ELONGATION FACTOR EEF1A
3wy9[2] C RL12_PYRHO 50S ribosomal protein L12[26 aa] A 25.0
/56.5
12
/12
EF1A_PYRHO Elongation factor 1-alpha
7csl[2] C EF1B_PYRHO Elongation factor 1-beta[88 aa] A 90.6
/56.3
32
/32
EF1A_PYRHO Elongation factor 1-alpha
3vmf[1] B RF1_AERPE Peptide chain release factor subunit 1[351 aa] A 51.6
/55.7
31
/31
EF1A_AERPE Elongation factor 1-alpha
3wxm[6] B PELO_AERPE Protein pelota homolog[357 aa] A 46.7
/55.7
30
/30
EF1A_AERPE Elongation factor 1-alpha
6ji2[1] E Archaeal ribosomal stalk protein aP1[9 aa] A 20.0
/55.7
10
/10
EF1A_AERPE Elongation factor 1-alpha
5it7[1] X Q6CP75_KLULA KLLA0E06997p[132 aa] EC 100.0
/44.1
1
/1
W7R097_YEASX Eft2p
7osm[1] RB A0A6L1AUB6_YEASX 40S ribosomal protein S24[134 aa] AC 100.0
/44.1
1
/1
A0A6A5Q7K2_YEASX Elongation factor 2
5lzw[4] HC PELO_HUMAN Pelota[372 aa] IC 39.5
/40.8
38
/38
HBS1L_HUMAN Hbs1l
4crn[1] B ERF1_YEAST ERF1 IN RIBOSOME-BOUND ERF1-ERF3-GDPNP COMPLEX[422.. A 30.4
/40.2
23
/23
ERF3_YEAST ERF3 IN RIBOSOME BOUND ERF1-ERF3-GDPNP COMPLEX
3e1y[2] B ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1[.. E 40.0
/31.1
10
/10
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
3j5y[3] A ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1[.. B 30.8
/39.7
39
/39
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
5lzt[1] HC ERF1_HUMAN eRF1[419 aa] IC 34.5
/40.0
29
/29
ERF3A_HUMAN eRF3a
3j7p[8] TA Ribosomal protein uL10[202 aa] VA 20.0
/34.8
10
/11
Eukaryotic elongation factor 2
7nwh[1] CB G1SPK4_RABIT 60S acidic ribosomal protein P0[196 aa] FA 50.0
/40.0
2
/2
eRF3a
3mca[1] B DOM34_SCHPO Protein dom34[341 aa] A 26.9
/39.0
26
/26
HBS1_SCHPO Elongation factor 1 alpha-like protein
5anb[1] I IF6_DICDI EUKARYOTIC TRANSLATION INITIATION FACTOR 6[224 aa].. K 25.0
/38.8
4
/31
ETUD1_HUMAN ELONGATION FACTOR TU GTP-BINDING DOMAIN-CONTAINING..
7unv[2] EA RL6_PSEAE 50S ribosomal protein L6[175 aa] X 100.0
/38.7
1
/1
IF2_PSEAE Translation initiation factor IF-2
1aip[4] C EFTS_THET8 ELONGATION FACTOR TS[195 aa] A 44.0
/38.5
25
/25
EFTU1_THETH ELONGATION FACTOR TU
1aip[4] D EFTS_THET8 ELONGATION FACTOR TS[195 aa] A 36.4
/38.5
11
/11
EFTU1_THETH ELONGATION FACTOR TU
1d8t[2] C THCL_PLARO THIOCILLIN GE2270[15 aa] A 50.0
/33.3
22
/22
EFTU_ECOLI ELONGATION FACTOR TU
2c77[1] B THCL_PLARO THIOCILLIN GE2270[15 aa] A 51.9
/38.5
27
/27
EFTU2_THET8 ELONGATION FACTOR TU-B
4v5g[2] SB RS12_THET8 30S RIBOSOMAL PROTEIN S12[125 aa] GC 0.0
/38.5
1
/1
EFTU1_THET8 ELONGATION FACTOR TU-A
4v5p[6] SB RS12_THET8 30S RIBOSOMAL PROTEIN S12[124 aa] GC 0.0
/38.2
1
/1
EFTU1_THET8 ELONGATION FACTOR TU
3v11[1] C IF2B_SULSO Translation initiation factor 2 subunit beta[17 aa.. A 30.0
/38.2
20
/22
IF2G_SULSO Translation initiation factor 2 subunit gamma
4v8q[1] HA SSRP_THET8 SMALL PROTEIN B SMPB[144 aa] HB 0.0
/38.1
1
/1
EFTU1_THET8 ELONGATION FACTOR TU
8v9l[1] IA RL11_MYCS2 50S ribosomal protein L11[133 aa] W 0.0
/38.0
3
/3
EFTU_MYCS2 Elongation factor Tu
8v9l[1] Y A0QRI6_MYCS2 Ribosome hibernation factor Balon (MSMEG_1130)[375.. W 0.0
/38.0
14
/14
EFTU_MYCS2 Elongation factor Tu
2qmu[7] C IF2B_SULSO Translation initiation factor 2 beta subunit[132 a.. A 36.8
/37.9
19
/23
IF2G_SULSO Translation initiation factor 2 gamma subunit
2qmu[2] C IF2B_SULSO Translation initiation factor 2 beta subunit[132 a.. A 0.0
/37.9
1
/14
IF2G_SULSO Translation initiation factor 2 gamma subunit
3cw2[1] L IF2B_SULSO Translation initiation factor 2 subunit beta[30 aa.. H 27.3
/37.9
11
/15
IF2G_SULSO Translation initiation factor 2 subunit gamma
6sw9[1] HA IF2B_SACS2 Translation initiation factor 2 subunit beta[129 a.. GA 21.7
/37.9
23
/25
IF2G_SACS2 Translation initiation factor 2 subunit gamma
5jb3[1] FA Protein translation factor SUI1 homolog[83 aa] HA 33.3
/37.6
3
/6
Translation initiation factor 2 subunit gamma
7o9k[1] NB MASU1_HUMAN Mitochondrial assembly of ribosomal large subunit .. GB 57.1
/37.5
14
/14
EFTU_HUMAN Elongation factor Tu, mitochondrial
7o9k[1] OB MIDUO_HUMAN MIEF1 upstream open reading frame protein[68 aa] GB 42.9
/37.5
7
/7
EFTU_HUMAN Elongation factor Tu, mitochondrial
7o9k[1] PB ACPM_HUMAN Acyl carrier protein, mitochondrial[87 aa] GB 33.3
/37.5
6
/6
EFTU_HUMAN Elongation factor Tu, mitochondrial
7o9k[1] T RM12_HUMAN 39S ribosomal protein L12, mitochondrial[70 aa] GB 16.7
/37.5
6
/6
EFTU_HUMAN Elongation factor Tu, mitochondrial
7o9k[1] U MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2[337 aa].. GB 0.0
/37.5
8
/8
EFTU_HUMAN Elongation factor Tu, mitochondrial
7vmx[1] A A0A045IDC3_MYCTX Elongation factor Ts[260 aa] B 42.9
/37.5
35
/35
A0A045IWT1_MYCTX Elongation factor Tu
4v6w[1] BC RL9_DROME 60S ribosomal protein L9[190 aa] A 0.0
/37.2
2
/6
EF2_DROME Elongation factor 2
1xb2[1] B EFTS_BOVIN Elongation factor Ts, mitochondrial[276 aa] A 37.5
/36.7
32
/32
EFTU_BOVIN Elongation factor Tu, mitochondrial
6vmi[1] LA RM14_HUMAN 39S ribosomal protein L14, mitochondrial[115 aa] JC 0.0
/36.5
1
/1
EFGM_HUMAN Elongation factor G, mitochondrial
3e20[2] D ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1[.. A 40.0
/36.3
10
/10
ERF3_SCHPO Eukaryotic peptide chain release factor GTP-bindin..
3e20[2] F ERF1_SCHPO Eukaryotic peptide chain release factor subunit 1[.. E 44.4
/36.3
9
/9
ERF3_SCHPO Eukaryotic peptide chain release factor GTP-bindin..
5kcs[1] H RL7_ECOLI 50S ribosomal protein L7/L12[69 aa] EB 0.0
/35.6
2
/2
TET9_ENTFL Tetracycline resistance protein TetM from transpos..
4iw3[2] A Q88CM1_PSEPK Putative uncharacterized protein[201 aa] B 51.6
/35.1
31
/31
EFTU1_PSEPK Elongation factor Tu-A
8hl1[4] I RL6_SULAC 50S ribosomal protein L6[181 aa] C 50.0
/34.7
2
/2
EF2_SULAC Elongation factor 2
8hl4[1] N RL14_SULAC 50S ribosomal protein L14[134 aa] SB 0.0
/34.9
1
/2
EF2_SULAC Elongation factor 2
3j7p[2] K I3LP78_PIG Ribosomal protein uL6[190 aa] VA 0.0
/34.8
2
/3
Eukaryotic elongation factor 2
4v6x[5] BC RL9_HUMAN 60S ribosomal protein L9[191 aa] A 0.0
/34.8
2
/3
EF2_HUMAN Elongation factor 2
5lzs[2] H G1TX33_RABIT uL6[190 aa] HC 100.0
/100.0
2
/2
EF1A1_RABIT Elongation factor 1-alpha 1
5lzt[1] H G1TX33_RABIT uL6[190 aa] IC 0.0
/40.0
1
/1
ERF3A_HUMAN eRF3a
6gz3[4] VA ribosomal protein uL6[191 aa] HC 0.0
/34.8
5
/6
eukaryotic elongation factor 2 (eEF2)
8g5z[1] QA RL9_HUMAN 60S ribosomal protein L9[190 aa] IC 100.0
/100.0
2
/2
EF1A1_RABIT Elongation factor 1-alpha 1
4v6x[1] MA RLA0_HUMAN 60S acidic ribosomal protein P0[280 aa] A 37.5
/34.8
8
/9
EF2_HUMAN Elongation factor 2
2d74[2] B IF2B_PYRFU Translation initiation factor 2 beta subunit[137 a.. A 21.9
/34.5
32
/37
IF2G_PYRFU Translation initiation factor 2 gamma subunit
4zv4[2] B Q9I739_PSEAE Tse6[162 aa] A 28.6
/34.0
14
/14
EFTU_PSEAE Elongation factor Tu
3j9y[2] EA RL6_ECOLI 50S ribosomal protein L6[176 aa] Q 0.0
/35.6
1
/1
TET9_ENTFL Tetracycline resistance protein TetM
3j9z[18] XA RL6_ECOLI 50S ribosomal protein L6[176 aa] X 0.0
/33.1
1
/6
EFG_ECOLI Elongation factor G
4v6l[1] GA RL6_ECOLI 50S ribosomal protein L6[176 aa] C 0.0
/33.3
2
/2
EFTU2_ECOLI Elongation factor Tu 2
7ssl[1] J RL6_ECOLI 50S ribosomal protein L6[176 aa] E 0.0
/33.8
1
/1
U9XYS4_ECOLX Elongation factor G
7st7[1] G RL6_ECOLI 50S ribosomal protein L6[176 aa] DB 0.0
/33.8
1
/5
U9Y1U4_ECOLX Elongation factor G
3u2q[5] B THCL_PLARO Thiocillin GE2270 analogue NVP-LFF571[12 aa] A 44.4
/32.8
18
/18
EFTU1_ECOLI Elongation factor Tu 1
4p3y[1] B B0V5X3_ACIBY Thiol:disulfide interchange protein[181 aa] A 15.4
/33.5
13
/13
EFTU1_ECOLI Elongation factor Tu 1
3izq[1] A DOM34_YEAST Protein DOM34[386 aa] B 23.5
/33.5
34
/40
HBS1_YEAST Elongation factor 1 alpha-like protein
2hcj[9] A EFTU_ECOLI Protein chain elongation factor EF-Tu[33 aa] B 38.1
/33.5
42
/43
EFTU_ECOLI Protein chain elongation factor EF-Tu
2hdn[1] E EFTU_ECOLI Elongation factor EF-Tu[33 aa] H 0.0
/33.4
1
/1
EFTU_ECOLI Elongation factor EF-Tu
5i4q[2] A Contact-dependent inhibitor A[88 aa] C 38.1
/29.1
21
/21
J7R9V6_ECOLX Elongation factor Tu
5i4r[2] A Contact-dependent inhibitor A[87 aa] C 36.8
/33.4
19
/19
EFTU1_ECO24 Elongation factor Tu
5i4q[2] B Contact-dependent inhibitor I[107 aa] C 28.6
/29.1
7
/7
J7R9V6_ECOLX Elongation factor Tu
5i4q[2] B Contact-dependent inhibitor I[107 aa] C 12.5
/29.1
8
/8
J7R9V6_ECOLX Elongation factor Tu
5i4r[2] D Contact-dependent inhibitor I[107 aa] C 20.0
/33.4
5
/5
EFTU1_ECO24 Elongation factor Tu
5i4r[2] H Contact-dependent inhibitor I[106 aa] C 25.0
/33.4
8
/8
EFTU1_ECO24 Elongation factor Tu
3mmp[4] B RDRP_BPQBE RNA-directed RNA polymerase beta chain[549 aa] A 40.0
/33.6
45
/60
EFTS_ECOLI EFTU2_ECOLI Elongation factor Tu 2, Elongation factor Ts
4q7j[2] C Q8LTE0_BPQBE Q beta replicase[547 aa] B 36.4
/33.5
33
/33
EFTU1_ECOLI Elongation factor Tu 1
4r71[2] E RS1_ECOLI 30S ribosomal protein S1[157 aa] A 0.0
/33.4
3
/3
EFTS_ECOLI EFTU2_ECOLI Elongation factor Ts, Elongation factor Tu
7vmc[1] B CDIA1_ECO5C tRNA nuclease CdiA[111 aa] A 43.8
/33.4
16
/16
E2QJ06_ECOLX Elongation factor Tu
4g5g[2] B thiomuracin A derivative[13 aa] A 47.1
/33.3
17
/17
EFTU1_ECOLI Elongation factor Tu 1
8qfs[2] C Q6RCQ4_LEGPN Protein SidH[1183 aa] A 34.5
/33.3
29
/29
E2QJ06_ECOLX Elongation factor Tu
1efu[2] B EFTS_ECOLI ELONGATION FACTOR TS[282 aa] A 38.6
/33.5
44
/44
EFTU_ECOLI ELONGATION FACTOR TU
1efu[2] D EFTS_ECOLI ELONGATION FACTOR TS[282 aa] A 0.0
/33.5
3
/3
EFTU_ECOLI ELONGATION FACTOR TU
4pc1[11] C C3TPM7_ECOLX Elongation factor Ts[280 aa] A 42.2
/33.7
45
/45
B1X6I9_ECODH Elongation factor Tu
4q7j[2] D RS1_ECOLI 30S ribosomal protein S1[177 aa] B 0.0
/33.5
2
/2
EFTU1_ECOLI Elongation factor Tu 1
4v6l[1] IA RL11_ECOLI 50S ribosomal protein L11[141 aa] C 0.0
/33.3
1
/1
EFTU2_ECOLI Elongation factor Tu 2
5lzd[1] GA RL11_ECOLI 50S ribosomal protein L11[141 aa] Y 0.0
/26.5
1
/1
SELB_ECOLI Selenocysteine-specific elongation factor
6wd2[4] H S1ERR4_ECOLX 50S ribosomal protein L11[141 aa] GB 0.0
/33.3
2
/2
E2QFJ4_ECOLX Elongation factor Tu
7abz[1] E SSRP_ECOLI SsrA-binding protein[146 aa] F 0.0
/33.1
1
/1
EFTU2_ECOLI Elongation factor Tu 2
4v6k[4] WA RS12_ECOLI 30S ribosomal protein S12[123 aa] JA 0.0
/33.3
1
/1
EFTU2_ECOLI Elongation factor Tu 2
7paq[3] DA RL6_MYCPN 50S ribosomal protein L6[176 aa] D 100.0
/31.8
1
/3
EFG_MYCPN Elongation factor G
5hxb[4] C CRBN_HUMAN Protein cereblon[380 aa] A 50.0
/31.1
10
/11
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
3e1y[2] C ERF1_HUMAN Eukaryotic peptide chain release factor subunit 1[.. G 30.8
/31.1
13
/13
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
4v85[1] VA C3SQZ2_ECOLX 50S ribosomal protein L14[122 aa] W 0.0
/31.1
1
/1
RF3_ECOLI Peptide chain release factor 3
6gwt[1] K RL14_ECOLI 50S ribosomal protein L14[122 aa] DB 0.0
/31.1
2
/2
RF3_ECO55 Peptide chain release factor 3
5a9z[2] GA Unknown peptide[128 aa] CB 0.0
/30.9
6
/6
BipA
4v5s[3] YC RL6_THET8 50S RIBOSOMAL PROTEIN L6[159 aa] GC 0.0
/38.2
1
/1
EFTU1_THET8 ELONGATION FACTOR TU
5a9z[1] H RL6_THET2 50S ribosomal protein L6[174 aa] CB 0.0
/30.9
1
/2
BipA
5j8b[1] H RL6_THET8 50S ribosomal protein L6[174 aa] GB 0.0
/30.4
1
/3
RL9_THET8 LEPA_THET8 GDPCP fused to the N-terminus of the ribosomal pro..
1zun[1] A CYSD_PSESM Sulfate adenylyltransferase subunit 2[204 aa] B 23.7
/30.3
59
/60
sulfate adenylate transferase, subunit 1/adenylyls..
7ase[1] A Q4E5Z1_TRYCC kDDX60[1523 aa] BA 20.0
/29.6
10
/10
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
7ase[1] E Q4E620_TRYCC Elongation initiation factor 2 alpha subunit, puta.. BA 11.1
/29.6
9
/14
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
7ase[1] G Q4DH88_TRYCC Translation initiation factor, putative[225 aa] BA 34.8
/29.6
23
/25
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
7ase[1] KA Q4DM75_TRYCC Protein translation factor SUI1 homolog, putative[.. BA 0.0
/29.6
3
/9
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
7ase[1] NA Q4DZB0_TRYCC Eukaryotic translation initiation factor 5, putati.. BA 30.0
/29.6
10
/22
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
2qn6[4] C IF2B_SULSO Translation initiation factor 2 beta subunit[18 aa.. A 35.0
/39.8
20
/25
IF2G_SULSO Translation initiation factor 2 gamma subunit
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5lzs[1] XA 18S ribosomal RNA HC 100.0
/100.0
9
/9
EF1A1_RABIT Elongation factor 1-alpha 1
6zmo[1] FC tRNA HC 100.0
/100.0
27
/27
EF1A1_HUMAN Elongation factor 1-alpha 1
6zmo[1] WA 18S ribosomal RNA HC 100.0
/100.0
8
/8
EF1A1_HUMAN Elongation factor 1-alpha 1
8g5z[1] A 18S rRNA IC 100.0
/100.0
10
/10
EF1A1_RABIT Elongation factor 1-alpha 1
8g5z[1] C 28S rRNA IC 100.0
/100.0
16
/16
EF1A1_RABIT Elongation factor 1-alpha 1
8g5z[3] FC A-site tRNA Phe IC 100.0
/100.0
27
/27
EF1A1_RABIT Elongation factor 1-alpha 1
8g60[1] A 18S rRNA HC 100.0
/100.0
9
/9
EF1A1_HUMAN eEF1A
8g60[1] C 28S rRNA HC 100.0
/100.0
1
/1
EF1A1_HUMAN eEF1A
8g6j[1] A 18S rRNA HC 100.0
/100.0
8
/8
EF1A1_HUMAN Elongation factor 1-alpha 1
8g6j[1] C 28S rRNA HC 100.0
/100.0
8
/8
EF1A1_HUMAN Elongation factor 1-alpha 1
8b6z[1] B 28S ribosomal RNA A 100.0
/92.5
8
/8
EF1A2_HUMAN Elongation factor 1-alpha 2
4cxg[2] E TRANSFER RNA C 62.5
/55.7
16
/16
ELONGATION FACTOR 1A
4cxg[2] F 18S RRNA - H5-H14 C 30.0
/55.7
10
/10
ELONGATION FACTOR 1A
4cxg[1] H 28S RRNA - H95 C 100.0
/55.7
1
/1
ELONGATION FACTOR 1A
4cxh[1] H 28S RRNA - H95 C 83.3
/55.7
6
/6
EF1A_AERPE ELONGATION FACTOR 1A
5it7[1] CC 18S ribosomal RNA EC 50.0
/44.1
2
/15
W7R097_YEASX Eft2p
5juo[1] A 18S ribosomal RNA DC 33.3
/44.1
3
/14
EF2_YEAST yeast eEF2
5juo[1] B 25S ribosomal RNA DC 100.0
/44.1
3
/24
EF2_YEAST yeast eEF2
6gq1[3] A Saccharomyces cerevisiae S288C 35S pre-ribosomal R.. EC 75.0
/44.1
4
/20
EF2_YEAST Elongation factor 2
6gq1[3] UA 18S ribosomal RNA EC 50.0
/44.1
2
/12
EF2_YEAST Elongation factor 2
7osa[1] A 25S rRNA BC 100.0
/44.1
4
/24
A0A6A5Q7K2_YEASX Elongation factor 2
7osm[1] A 25S rRNA AC 100.0
/44.1
5
/19
A0A6A5Q7K2_YEASX Elongation factor 2
8cf5[2] IB 18S ribosomal RNA L 40.0
/44.1
5
/14
A0A6A5Q7K2_YEASX Elongation factor 2
8cf5[2] K 25S ribosomal RNA L 100.0
/44.1
6
/20
A0A6A5Q7K2_YEASX Elongation factor 2
8cg8[1] K 25S ribosomal RNA L 100.0
/44.1
5
/29
A0A6A5Q7K2_YEASX Elongation factor 2
5lzt[1] YA 18S ribosomal RNA IC 80.0
/40.0
5
/5
ERF3A_HUMAN eRF3a
5lzw[4] YA 18S ribosomal RNA IC 25.0
/40.8
4
/4
HBS1L_HUMAN Hbs1l
4d61[1] A 18S RRNA JA 70.0
/40.0
10
/10
ERF3A_HUMAN EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-BINDIN..
5lzs[1] UA 28S ribosomal RNA HC 100.0
/100.0
8
/8
EF1A1_RABIT Elongation factor 1-alpha 1
5lzt[1] VA 28S ribosomal RNA IC 37.5
/40.0
8
/8
ERF3A_HUMAN eRF3a
7nwh[1] XB 18S Ribosomal RNA FA 22.2
/40.0
9
/9
eRF3a
5anc[1] K 26S RIBOSOMAL RNA J 44.4
/38.8
9
/27
ETUD1_HUMAN ELONGATION FACTOR TU GTP-BINDING DOMAIN-CONTAINING..
7unv[2] Y 23S Ribosomal RNA X 80.0
/38.7
5
/13
IF2_PSEAE Translation initiation factor IF-2
4v5g[2] FC A-SITE TRNA THR GC 37.8
/38.5
37
/37
EFTU1_THET8 ELONGATION FACTOR TU-A
4v5g[2] RC 23S RIBOSOMAL RNA GC 80.0
/38.5
5
/5
EFTU1_THET8 ELONGATION FACTOR TU-A
4v5g[7] HB 16S RIBOSOMAL RNA GC 50.0
/38.5
8
/8
EFTU1_THET8 ELONGATION FACTOR TU-A
4v5l[5] Y A-SITE TRNA G24A TRP-TRNA TRP Z 41.0
/38.3
39
/39
EFTU2_THET8 ELONGATION FACTOR TU
4v5p[2] FC A-SITE TRNA A9C TRP-TRNA TRP GC 40.5
/38.2
37
/37
EFTU1_THET8 ELONGATION FACTOR TU
4v5p[4] HB 16S RRNA GC 37.5
/38.2
8
/8
EFTU1_THET8 ELONGATION FACTOR TU
4v5r[2] FC A-SITE TRNA TRP-TRNA TRP GC 43.8
/38.2
32
/33
EFTU1_THET8 ELONGATION FACTOR TU
1b23[1] A CYSTEINYL TRNA B 46.7
/38.2
30
/31
EFTU_THEAQ ELONGATION FACTOR TU
1ob5[3] B TRANSFER-RNA, PHE A 46.3
/38.2
41
/41
EFTU_THEAQ ELONGATION FACTOR TU
1ob5[3] F TRANSFER-RNA, PHE A 0.0
/38.2
5
/5
EFTU_THEAQ ELONGATION FACTOR TU
1ttt[3] A TRANSFER RIBONUCLEIC ACID (YEAST, PHE) D 42.4
/38.2
33
/33
EFTU_THEAQ OF ELONGATION FACTOR TU (EF-TU)
1zc8[1] A TLD 16S ribosomal RNA K 0.0
/38.2
2
/2
Elongation factor Tu
3v11[1] D Initiator tRNA A 66.7
/38.2
3
/16
IF2G_SULSO Translation initiation factor 2 subunit gamma
4v68[1] A 16S rRNA AA 33.3
/38.2
9
/9
EFTU2_THET8 Elongation factor Tu-A
4v68[1] LA 23S rRNA AA 100.0
/38.2
2
/2
EFTU2_THET8 Elongation factor Tu-A
4v68[1] Y AT-SITE TRNA AA 34.6
/38.2
26
/26
EFTU2_THET8 Elongation factor Tu-A
4v8q[1] GB TMRNA DELA HB 50.0
/38.1
32
/32
EFTU1_THET8 ELONGATION FACTOR TU
4v8q[1] IA 16S ribosomal RNA HB 28.6
/38.1
7
/7
EFTU1_THET8 ELONGATION FACTOR TU
4v8q[1] K 23S ribosomal RNA HB 66.7
/38.1
3
/3
EFTU1_THET8 ELONGATION FACTOR TU
8v9l[1] A 16S Ribosomal RNA W 33.3
/38.0
6
/6
EFTU_MYCS2 Elongation factor Tu
8v9l[1] Z 23S Ribosomal RNA W 100.0
/38.0
1
/1
EFTU_MYCS2 Elongation factor Tu
3qsy[1] C tRNA A 9.1
/37.9
11
/29
IF2G_SULSO Translation initiation factor 2 subunit gamma
6swc[1] EA initiator Met-tRNA fMet from E. coli (A1U72 varian.. GA 0.0
/37.9
1
/9
Translation initiation factor 2 subunit gamma
4v6k[2] HA 16S ribosomal RNA JA 33.3
/33.3
9
/11
EFTU2_ECOLI Elongation factor Tu 2
4v6v[1] V 16S ribosomal RNA U 100.0
/37.8
1
/20
TETO_CAMJU Tetracycline resistance protein TetO
4v6v[1] EB 23S ribosomal RNA U 80.0
/37.8
5
/24
TETO_CAMJU Tetracycline resistance protein TetO
5jb3[1] DA initiator Met-tRNA fMet from E. coli (A1U72 varian.. HA 66.7
/37.6
3
/16
Translation initiation factor 2 subunit gamma
7o9k[1] L 16S rRNA GB 33.3
/37.5
3
/4
EFTU_HUMAN Elongation factor Tu, mitochondrial
4v6w[1] EC 28S ribosomal RNA A 83.3
/37.2
6
/27
EF2_DROME Elongation factor 2
5lzs[1] GC tRNA HC 100.0
/100.0
28
/28
EF1A1_RABIT Elongation factor 1-alpha 1
7a5g[1] MC E tRNA LC 50.0
/36.8
22
/22
EFTU_HUMAN Elongation factor Tu, mitochondrial
7a5g[1] HC 12S rRNA LC 28.6
/36.8
7
/7
EFTU_HUMAN Elongation factor Tu, mitochondrial
3deg[1] F 50S RNA helix 95 I 66.7
/36.7
3
/10
LEPA_ECOLI GTP-binding protein lepA
6ydp[1] AC 12S rRNA CC 77.8
/36.5
9
/31
EFGM_HUMAN Elongation factor G, mitochondrial
6ydw[1] CC 12S rRNA EC 66.7
/36.5
6
/28
EFGM_HUMAN Elongation factor G, mitochondrial
7a5g[1] B 16S rRNA LC 100.0
/36.8
1
/1
EFTU_HUMAN Elongation factor Tu, mitochondrial
7a5k[1] C 16S rRNA A 62.5
/36.5
8
/20
EFGM_HUMAN Elongation factor G, mitochondrial
4v9h[1] Y 23S ribosomal RNA W 80.0
/36.5
5
/23
EFG_THET8 Elongation factor G
3jce[1] BA 23 ribosomal RNA EB 62.5
/36.2
8
/42
LEPA_ECOLI Elongation factor 4
4v90[1] IA 23S RIBOSOMAL RNA X 75.0
/36.0
8
/21
EFG_THET8 ELONGATION FACTOR G
4v9j[4] RD 23S ribosomal RNA FC 50.0
/36.0
6
/27
EFG_THET2 Elongation factor G
1mj1[1] A Phe-tRNA E 36.4
/36.0
11
/16
Elongation Factor Tu
5kcs[1] A 23S Ribosomal RNA EB 100.0
/35.6
1
/6
TET9_ENTFL Tetracycline resistance protein TetM from transpos..
4v9o[8] C 23S rRNA CB 57.1
/35.3
7
/19
EFG_ECOLI Elongation factor G
6mte[1] A 28S rRNA VA 57.1
/35.0
7
/25
eEF2
8hl4[1] A 23s rRNA (3000-MER) SB 57.1
/34.9
7
/16
EF2_SULAC Elongation factor 2
3j7p[1] A 28S ribosomal RNA VA 66.7
/34.8
6
/21
Eukaryotic elongation factor 2
4v6x[1] IC 28S ribosomal RNA A 57.1
/34.8
7
/21
EF2_HUMAN Elongation factor 2
6d9j[1] SA 28S rRNA FC 100.0
/34.8
5
/22
EF2_HUMAN eEF2
6gz3[3] A 28S ribosomal RNA HC 66.7
/34.8
9
/25
eukaryotic elongation factor 2 (eEF2)
6z6m[2] A 28S rRNA DC 62.5
/34.8
8
/23
EF2_HUMAN Elongation factor 2
7ls2[1] I 28S rRNA AC 66.7
/34.8
3
/17
EF2_MOUSE Elongation factor 2
7ls2[1] TA 18S rRNA AC 0.0
/34.8
1
/13
EF2_MOUSE Elongation factor 2
8y0w[1] C 28S rRNA B 66.7
/34.8
9
/23
EF2_HUMAN Elongation factor 2
7paj[5] BB tRNA-Phe D 31.6
/34.7
19
/19
EFTU_MYCPN Elongation factor Tu
8hl1[1] B 23s rRNA (3000-MER) C 66.7
/34.7
6
/13
EF2_SULAC Elongation factor 2
8hl2[1] A 23s rRNA (3000-MER) C 66.7
/34.7
6
/13
EF2_SULAC Elongation factor 2
8hl3[1] A 23s rRNA (3000-MER) C 50.0
/34.7
4
/11
EF2_SULAC Elongation factor 2
7pjv[3] H 23S ribosomal RNA EB 44.4
/33.8
9
/21
EFG_ECOLI Elongation factor G
5uyk[14] AB 16S ribosomal RNA HB 40.0
/33.3
5
/6
EFTU1_ECOLI Elongation factor Tu 2
6gwt[1] HA 16S ribosomal RNA DB 25.0
/31.1
4
/16
RF3_ECO55 Peptide chain release factor 3
7ssl[2] A 16S rRNA E 0.0
/33.8
2
/16
U9XYS4_ECOLX Elongation factor G
5uym[2] BB 23S ribosomal RNA HB 85.7
/33.3
7
/7
EFTU1_ECOLI Elongation factor Tu 2
6wd9[1] AB 23S ribosomal RNA GB 100.0
/32.8
1
/1
E2QFJ4_ECOLX Elongation factor Tu
7k51[4] BB 23S ribosomal RNA GB 42.9
/35.3
7
/23
H4UQ46_ECOLX Elongation factor G
7ssl[2] B 23S rRNA E 55.6
/33.8
9
/21
U9XYS4_ECOLX Elongation factor G
7n2v[1] A 16S rRNA DB 0.0
/33.8
2
/16
A0A0H3PU63_ECO5C Elongation factor G
7n2v[1] W 23S rRNA DB 50.0
/33.8
8
/22
A0A0H3PU63_ECO5C Elongation factor G
7pjv[2] HA 16S ribosomal RNA EB 0.0
/33.8
2
/23
EFG_ECOLI Elongation factor G
1ls2[1] A Phenylalanine transfer RNA B 0.0
/33.5
1
/1
EFTU_ECOLI Elongation Factor Tu
4v69[1] V A/T-site tRNA Phe Y 31.4
/33.3
35
/36
EFTU_ECOLI Elongation factor Tu
1ob2[1] B TRANSFER-RNA, PHE A 27.9
/33.3
43
/43
EFTU2_ECOLI ELONGATION FACTOR TU
3avu[1] C RNA (5'-R(*AP*UP*CP*GP*UP*GP*GP*AP*CP*CP*CP*A)-3').. A 0.0
/33.3
1
/30
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3avv[1] C RNA (5'-R(*AP*AP*CP*GP*AP*UP*GP*GP*AP*CP*CP*CP*A)-.. A 0.0
/33.3
1
/33
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3avw[1] C RNA (5'-R(*AP*UP*CP*GP*UP*GP*GP*AP*CP*CP*CP*A)-3').. A 0.0
/33.3
2
/30
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3avx[1] C RNA (5'-R(*AP*AP*CP*GP*AP*UP*GP*GP*AP*CP*CP*CP*A)-.. A 33.3
/33.3
6
/36
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3avy[1] C RNA (5'-R(*AP*AP*CP*GP*AP*UP*UP*UP*UP*AP*UP*GP*GP*.. A 12.5
/33.3
8
/44
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3vnu[2] C RNA (5'-R(*GP*GP*GP*UP*AP*GP*GP*G)-3') A 0.0
/33.3
1
/13
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3vnv[1] C RNA (5'-R(*GP*GP*GP*UP*AP*GP*GP*G)-3') A 0.0
/33.3
1
/22
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
4v69[1] EB 23S ribosomal RNA Y 66.7
/33.3
3
/3
EFTU_ECOLI Elongation factor Tu
4v69[1] U 16S rRNA Y 36.4
/33.3
11
/11
EFTU_ECOLI Elongation factor Tu
4v6k[2] B ribosomal RNA 23S JA 80.0
/33.3
5
/5
EFTU2_ECOLI Elongation factor Tu 2
4v6k[2] IA A/T-site tRNA Phe JA 32.4
/33.3
34
/34
EFTU2_ECOLI Elongation factor Tu 2
5uyn[3] GB tRNALys HB 30.8
/33.3
39
/39
EFTU1_ECOLI Elongation factor Tu 2
6vlz[2] FA 16s rRNA JC 42.9
/36.5
7
/27
EFGM_HUMAN Elongation factor G, mitochondrial
7l20[1] A 16S rRNA mitochondrial FB 50.0
/33.3
8
/35
RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial
7nsh[1] HA 16S rRNA PA 66.7
/33.3
6
/24
RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial
8qfs[2] B tRNA A 26.5
/33.3
34
/34
E2QJ06_ECOLX Elongation factor Tu
5uyk[11] GB tRNAPhe HB 29.7
/33.3
37
/37
EFTU1_ECOLI Elongation factor Tu 2
3j9y[1] Y 23S ribosomal RNA Q 100.0
/35.6
1
/4
TET9_ENTFL Tetracycline resistance protein TetM
5afi[1] AA 23S ribosomal RNA Z 66.7
/33.1
6
/6
EFTU2_ECOLI Elongation factor Tu 2
5afi[1] Y A/T-site Phe-tRNAPhe Z 30.3
/33.1
33
/33
EFTU2_ECOLI Elongation factor Tu 2
7abz[1] A 23S ribosomal RNA F 100.0
/33.1
1
/1
EFTU2_ECOLI Elongation factor Tu 2
7abz[1] B 16S ribosomal RNA F 42.9
/33.1
7
/7
EFTU2_ECOLI Elongation factor Tu 2
7abz[1] D transfer-messenger RNA (tmRNA) F 23.3
/33.1
30
/31
EFTU2_ECOLI Elongation factor Tu 2
3j9z[1] Y 23S ribosomal RNA X 57.1
/33.1
7
/24
EFG_ECOLI Elongation factor G
3ja1[1] B 16S ribosomal RNA X 50.0
/33.1
2
/13
EFG_ECOLI Elongation factor G
3ja1[1] Z 23S ribosomal RNA X 40.0
/33.1
5
/20
EFG_ECOLI Elongation factor G
5afi[2] A 16S ribosomal RNA Z 28.6
/33.1
7
/7
EFTU2_ECOLI Elongation factor Tu 2
5lzb[3] A 16S ribosomal RNA Y 33.3
/26.5
6
/19
SELB_ECOLI Selenocysteine-specific elongation factor
5we6[1] A 23S rRNA GB 50.0
/33.1
10
/10
EFTU2_ECOLI Elongation factor Tu 2
5we6[1] FB Phe-tRNA-Phe GB 24.0
/33.1
25
/25
EFTU2_ECOLI Elongation factor Tu 2
4v5l[9] KA 23S RIBOSOMAL RNA Z 85.7
/38.3
7
/7
EFTU2_THET8 ELONGATION FACTOR TU
4v8o[1] IA 23S RIBOSOMAL RNA X 100.0
/32.1
1
/7
RF3_ECODH PEPTIDE CHAIN RELEASE FACTOR 3
7paj[5] AB 16S ribosomal RNA D 28.6
/34.7
7
/8
EFTU_MYCPN Elongation factor Tu
7pao[5] BB 16S ribosomal RNA D 14.3
/31.8
7
/32
EFG_MYCPN Elongation factor G
7pao[6] ZA 23S ribosomal RNA D 33.3
/31.8
9
/25
EFG_MYCPN Elongation factor G
4v85[2] HA 23S rRNA W 75.0
/31.1
4
/16
RF3_ECOLI Peptide chain release factor 3
6lkq[1] CB 23S ribosomal RNA EB 40.0
/31.1
5
/12
C3SE77_ECOLX Peptide chain release factor 3
5a9z[2] A 23S ribosomal RNA CB 33.3
/30.9
9
/26
BipA
5a9z[2] HA 16S ribosomal RNA CB 0.0
/30.9
4
/6
BipA
5imq[2] F 16S ribosomal RNA DB 0.0
/30.4
1
/2
LEPA_THET8 Elongation factor 4
5imq[2] G 23S ribosomal RNA DB 57.1
/30.4
7
/33
LEPA_THET8 Elongation factor 4
5j8b[1] A 23S Ribosomal RNA GB 57.1
/30.4
7
/30
RL9_THET8 LEPA_THET8 GDPCP fused to the N-terminus of the ribosomal pro..
5j8b[1] HA 16S Ribosomal RNA GB 20.0
/30.4
5
/6
RL9_THET8 LEPA_THET8 GDPCP fused to the N-terminus of the ribosomal pro..
7ase[1] B initiator tRNA-Met BA 28.6
/29.6
14
/17
Q4CPV7_TRYCC Eukaryotic translation initiation factor 2 subunit..
5lzb[3] X Sec-tRNASec Y 37.5
/26.5
24
/33
SELB_ECOLI Selenocysteine-specific elongation factor
5lzd[1] Z 23S ribosomal RNA Y 57.1
/26.5
7
/7
SELB_ECOLI Selenocysteine-specific elongation factor
7zjw[1] B human Ser-tRNA-Sec A 33.3
/25.7
15
/23
SELB_HUMAN eEFSec
7zjw[1] F 28S rRNA A 33.3
/25.7
3
/4
SELB_HUMAN eEFSec
7zjw[1] ZA 18S rRNA A 20.0
/25.7
5
/7
SELB_HUMAN eEFSec
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1ttt[3] H PHE
PHENYLALANINE[11 atoms]
D 60.0
/38.2
10
/10
EFTU_THEAQ OF ELONGATION FACTOR TU (EF-TU)
4cxg[2] J PHE
PHENYLALANINE[11 atoms]
C 100.0
/55.7
3
/3
ELONGATION FACTOR 1A
5uyl[11] JB PHE
PHENYLALANINE[11 atoms]
HB 55.6
/33.3
9
/9
EFTU1_ECOLI Elongation factor Tu 2
8g5z[1] RV PHE
PHENYLALANINE[11 atoms]
IC 100.0
/100.0
10
/10
EF1A1_RABIT Elongation factor 1-alpha 1
8g60[2] JV PHE
PHENYLALANINE[11 atoms]
HC 100.0
/100.0
10
/10
EF1A1_HUMAN eEF1A
8g6j[1] RR GSP
5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE[32 atom..
HC 100.0
/100.0
21
/21
EF1A1_HUMAN Elongation factor 1-alpha 1
8g6j[1] TR YRB
(3R,6R,9S,12S,15S,18S,20R,24aR)-6-[(2S)-butan-2-yl..
HC 100.0
/100.0
19
/19
EF1A1_HUMAN Elongation factor 1-alpha 1
6ra9[2] C GPE
L-ALPHA-GLYCEROPHOSPHORYLETHANOLAMINE[13 atoms]
A 100.0
/92.4
2
/2
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] D GPE
L-ALPHA-GLYCEROPHOSPHORYLETHANOLAMINE[13 atoms]
A 100.0
/92.4
3
/3
EF1A2_RABIT Elongation factor 1-alpha 2
5o8w[1] C GLN
GLUTAMINE[10 atoms]
A 100.0
/81.7
4
/4
EF1A_YEAST Elongation factor 1-alpha
3i1f[1] C GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
A 0.0
/37.9
1
/12
IF2G_SULSO Translation initiation factor 2 subunit gamma
3i1f[23] F GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
B 66.7
/37.9
9
/9
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] AA GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
A 100.0
/38.5
1
/11
IF2G_SULSO Translation initiation factor 2 subunit gamma
5it7[1] NF GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
EC 91.7
/44.1
12
/18
W7R097_YEASX Eft2p
5izl[3] D GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
A 65.2
/28.5
23
/23
SELB_HUMAN Selenocysteine-specific elongation factor
5lzt[1] MN GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
IC 75.0
/40.0
24
/24
ERF3A_HUMAN eRF3a
5lzw[4] MN GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
IC 83.3
/40.8
18
/18
HBS1L_HUMAN Hbs1l
6u43[4] B GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
A 63.6
/39.7
11
/18
A0A062V290_9EURY Elongation factor 2
7a5g[1] WH GCP
PHOSPHOMETHYLPHOSPHONIC ACID GUANYLATE ESTER[32 at..
LC 70.6
/36.8
17
/17
EFTU_HUMAN Elongation factor Tu, mitochondrial
4h9g[1] M 14J
5-bromofuran-2-carboxylic acid[9 atoms]
A 50.0
/38.5
8
/8
EFTU1_THETH Elongation factor Tu-A
1ha3[3] E MAU
N-METHYL KIRROMYCIN[58 atoms]
A 45.0
/37.6
20
/24
EFTU_THETH ELONGATION FACTOR TU
4v68[1] IB PHA
PHENYLALANINAL[11 atoms]
AA 62.5
/38.2
8
/8
EFTU2_THET8 Elongation factor Tu-A
1d2e[131] F GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 66.7
/37.0
15
/15
EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)
1r5n[1] B GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 68.8
/41.2
16
/16
ERF2_SCHPO Eukaryotic peptide chain release factor GTP-bindin..
2hcj[9] E GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
B 42.9
/33.5
7
/7
EFTU_ECOLI Protein chain elongation factor EF-Tu
4iw3[7] G GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
B 78.6
/35.1
14
/14
EFTU1_PSEPK Elongation factor Tu-A
2pmd[2] F PPV
PYROPHOSPHATE[9 atoms]
A 0.0
/37.9
1
/3
IF2G_SULSO Translation initiation factor 2 gamma subunit
3qsy[1] E MET
METHIONINE[8 atoms]
A 100.0
/37.9
1
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
3v11[4] G MET
METHIONINE[8 atoms]
A 0.0
/38.2
1
/8
IF2G_SULSO Translation initiation factor 2 subunit gamma
4rjl[1] AA 7PG
2,5,8,11,14,17,20,23-OCTAOXAPENTACOSAN-25-OL[26 at..
A 16.7
/37.9
6
/11
IF2G_SULSO Translation initiation factor 2 subunit gamma
1g7c[1] C 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
A 100.0
/81.7
10
/10
EF1A_YEAST ELONGATION FACTOR 1-ALPHA
4ac9[3] L 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms]
B 28.6
/35.5
7
/9
Q8J307_METMI MJ0495-LIKE PROTEIN
4iw3[2] F OGA
N-OXALYLGLYCINE[10 atoms]
B 0.0
/35.1
1
/1
EFTU1_PSEPK Elongation factor Tu-A
4ac9[6] K DXC
(3ALPHA,5BETA,12ALPHA)-3,12-DIHYDROXYCHOLAN-24-OIC..
B 41.7
/35.5
12
/12
Q8J307_METMI MJ0495-LIKE PROTEIN
4ac9[3] U DXC
(3ALPHA,5BETA,12ALPHA)-3,12-DIHYDROXYCHOLAN-24-OIC..
C 40.0
/35.0
5
/8
Q8J307_METMI MJ0495-LIKE PROTEIN
4ac9[6] V DXC
(3ALPHA,5BETA,12ALPHA)-3,12-DIHYDROXYCHOLAN-24-OIC..
C 25.0
/35.0
8
/8
Q8J307_METMI MJ0495-LIKE PROTEIN
1b23[54] I GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
B 61.1
/38.2
18
/18
EFTU_THEAQ ELONGATION FACTOR TU
1r5o[1] B GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 73.3
/41.4
15
/15
ERF2_SCHPO Eukaryotic peptide chain release factor GTP-bindin..
2pmd[2] D GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 0.0
/37.9
1
/18
IF2G_SULSO Translation initiation factor 2 gamma subunit
3sjz[1] C GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 33.3
/34.4
3
/16
IF2G_SULSO Translation initiation factor 2 subunit gamma
5izm[2] D GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 55.0
/26.4
20
/20
SELB_HUMAN Selenocysteine-specific elongation factor
5lzb[3] IB GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
Y 61.1
/26.5
18
/18
SELB_ECOLI Selenocysteine-specific elongation factor
7nsh[1] TJ GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
PA 75.0
/33.3
16
/19
RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial
1ob5[3] I ENX
ENACYLOXIN IIA[47 atoms]
A 43.8
/38.2
16
/20
EFTU_THEAQ ELONGATION FACTOR TU
2bvn[2] E ENX
ENACYLOXIN IIA[47 atoms]
A 31.6
/34.4
19
/19
EFTU_ECOLI ELONGATION FACTOR TU
2c78[2] D PUL
(1S,2S,3E,5E,7E,10S,11S,12S)-12-[(2R,4E,6E,8Z,10R,..
A 70.0
/38.7
30
/30
EFTU1_THET8 ELONGATION FACTOR TU-A
4zu9[1] G CYS
CYSTEINE[7 atoms]
A 20.0
/33.7
5
/5
O67141_AQUAE Elongation factor SelB
3mmp[2] E PXN
(2S)-1-[3-{[(2R)-2-hydroxypropyl]oxy}-2,2-bis({[(2..
A 0.0
/33.6
1
/1
EFTS_ECOLI EFTU2_ECOLI Elongation factor Tu 2, Elongation factor Ts
8fr3[1] E Y7C
3-chloro-N-(1-propyl-1H-tetrazol-5-yl)benzamide[18..
A 16.7
/33.5
6
/6
E2QFJ4_ECOLX Elongation factor Tu
2hcj[13] I TAC
TETRACYCLINE[32 atoms]
B 60.0
/33.5
5
/5
EFTU_ECOLI Protein chain elongation factor EF-Tu
1wdt[18] C GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 64.3
/32.3
14
/17
Q5SI76_THET8 elongation factor G homolog
4zke[4] C GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 54.5
/28.9
22
/23
SKI7_YEAST Superkiller protein 7
7zjw[1] IC GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 53.8
/25.7
13
/13
SELB_HUMAN eEFSec
5uyp[2] JB LYS
LYSINE[9 atoms]
HB 55.6
/33.3
9
/9
EFTU1_ECOLI Elongation factor Tu 2
1ob2[14] D KIR
KIRROMYCIN[57 atoms]
A 38.1
/33.3
21
/21
EFTU2_ECOLI ELONGATION FACTOR TU
5hxb[2] H 85C
1-(3-chloro-4-methylphenyl)-3-({2-[(3S)-2,6-dioxop..
A 45.5
/31.1
11
/12
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
6xk9[2] G V4M
2-(4-chlorophenyl)-N-({2-[(3S)-2,6-dioxopiperidin-..
A 55.6
/31.4
9
/10
ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-bindin..
3vr1[4] E G4P
GUANOSINE-5',3'-TETRAPHOSPHATE[36 atoms]
A 81.8
/31.3
11
/15
RF3_DESVM Peptide chain release factor 3
5a9y[2] B G4P
GUANOSINE-5',3'-TETRAPHOSPHATE[36 atoms]
A 53.8
/30.9
13
/13
B7MHF0_ECO45 GTP-BINDING PROTEIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2xex[1] E K
POTASSIUM ION[1 atoms]
B 0.0
/38.7
1
/4
EFG_STAAU ELONGATION FACTOR G
4h9g[1] D NH4
AMMONIUM ION[1 atoms]
A 60.0
/38.5
5
/5
EFTU1_THETH Elongation factor Tu-A
4lbv[9] D NH4
AMMONIUM ION[1 atoms]
A 60.0
/38.5
5
/5
EFTU1_THETH Elongation factor Tu-A
2hcj[1] F NA
SODIUM ION[1 atoms]
B 0.0
/33.5
2
/2
EFTU_ECOLI Protein chain elongation factor EF-Tu
2hcj[1] G NA
SODIUM ION[1 atoms]
B 0.0
/33.5
2
/2
EFTU_ECOLI Protein chain elongation factor EF-Tu
2hcj[1] H NA
SODIUM ION[1 atoms]
B 100.0
/33.5
2
/4
EFTU_ECOLI Protein chain elongation factor EF-Tu
4m4s[2] HA NA
SODIUM ION[1 atoms]
A 0.0
/35.4
4
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[5] IA NA
SODIUM ION[1 atoms]
A 0.0
/35.4
1
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[5] JA NA
SODIUM ION[1 atoms]
A 0.0
/35.4
1
/1
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[5] KA NA
SODIUM ION[1 atoms]
A 0.0
/35.4
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] EA NA
SODIUM ION[1 atoms]
A 0.0
/38.5
1
/1
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] GA NA
SODIUM ION[1 atoms]
A 25.0
/38.5
4
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] JA NA
SODIUM ION[1 atoms]
A 33.3
/38.5
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4zke[1] D NA
SODIUM ION[1 atoms]
A 25.0
/28.9
4
/4
SKI7_YEAST Superkiller protein 7
5opd[1] LA NA
SODIUM ION[1 atoms]
B 50.0
/36.4
2
/2
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] MA NA
SODIUM ION[1 atoms]
B 100.0
/36.4
2
/2
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] NA NA
SODIUM ION[1 atoms]
B 100.0
/36.4
1
/4
EFTU1_ECOHS Elongation factor Tu 1
6ji2[2] H NA
SODIUM ION[1 atoms]
A 100.0
/55.7
2
/2
EF1A_AERPE Elongation factor 1-alpha
6r8t[1] AA NA
SODIUM ION[1 atoms]
A 33.3
/37.9
3
/3
A0A0E3JTX3_SACSO Translation initiation factor 2 subunit gamma
7vmx[1] F ZN
ZINC ION[1 atoms]
B 0.0
/37.5
1
/1
A0A045IWT1_MYCTX Elongation factor Tu
7vmx[2] G ZN
ZINC ION[1 atoms]
B 0.0
/37.5
1
/1
A0A045IWT1_MYCTX Elongation factor Tu
7vmx[1] I ZN
ZINC ION[1 atoms]
B 0.0
/37.5
2
/2
A0A045IWT1_MYCTX Elongation factor Tu
5opd[3] C IOD
IODIDE ION[1 atoms]
A 100.0
/37.4
4
/4
EFTU1_ECOHS Elongation factor Tu 1
5opd[2] D IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
2
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[4] H IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
2
/4
EFTU1_ECOHS Elongation factor Tu 1
5opd[2] I IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
3
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[2] J IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
2
/2
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] K IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
1
/4
EFTU1_ECOHS Elongation factor Tu 1
5opd[2] O IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
2
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] P IOD
IODIDE ION[1 atoms]
A 0.0
/37.4
3
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] FA IOD
IODIDE ION[1 atoms]
B 33.3
/36.4
3
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] GA IOD
IODIDE ION[1 atoms]
B 33.3
/36.4
3
/3
EFTU1_ECOHS Elongation factor Tu 1
5opd[1] Z IOD
IODIDE ION[1 atoms]
B 50.0
/36.4
2
/2
EFTU1_ECOHS Elongation factor Tu 1
4lbv[2] E CL
CHLORIDE ION[1 atoms]
A 40.0
/38.5
5
/5
EFTU1_THETH Elongation factor Tu-A
4pc2[2] F CL
CHLORIDE ION[1 atoms]
A 0.0
/33.7
3
/3
B1X6I9_ECODH Elongation factor Tu
4pc2[1] L CL
CHLORIDE ION[1 atoms]
C 0.0
/33.9
5
/5
B1X6I9_ECODH Elongation factor Tu
4rd0[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/39.8
2
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
5mi8[1] Q CL
CHLORIDE ION[1 atoms]
B 50.0
/33.4
4
/4
EFTU1_ECOHS Elongation factor Tu 1
1b23[178] F MG
MAGNESIUM ION[1 atoms]
B 66.7
/38.2
3
/3
EFTU_THEAQ ELONGATION FACTOR TU
1ijf[1] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/81.8
1
/1
EF1A_YEAST elongation factor 1-alpha
1skq[2] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/55.5
1
/1
EF1A_SULSO Elongation factor 1-alpha
3j7p[2] GH MG
MAGNESIUM ION[1 atoms]
VA 100.0
/34.8
1
/1
Eukaryotic elongation factor 2
3pen[1] E MG
MAGNESIUM ION[1 atoms]
A 0.0
/38.5
1
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
3pen[2] G MG
MAGNESIUM ION[1 atoms]
A 25.0
/38.5
4
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
3pen[1] H MG
MAGNESIUM ION[1 atoms]
A 0.0
/38.5
1
/1
IF2G_SULSO Translation initiation factor 2 subunit gamma
3wnb[11] C MG
MAGNESIUM ION[1 atoms]
A 50.0
/25.9
2
/4
Q8PXB3_METMA Protein translation elongation factor 1A
4g5g[2] E MG
MAGNESIUM ION[1 atoms]
A 0.0
/33.3
1
/1
EFTU1_ECOLI Elongation factor Tu 1
4rjl[1] C MG
MAGNESIUM ION[1 atoms]
A 50.0
/37.9
2
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4v5g[2] ZD MG
MAGNESIUM ION[1 atoms]
GC 0.0
/38.5
1
/1
EFTU1_THET8 ELONGATION FACTOR TU-A
5lzb[3] JB MG
MAGNESIUM ION[1 atoms]
Y 66.7
/26.5
3
/3
SELB_ECOLI Selenocysteine-specific elongation factor
5lzd[1] PC MG
MAGNESIUM ION[1 atoms]
Y 50.0
/26.5
2
/2
SELB_ECOLI Selenocysteine-specific elongation factor
5lzd[1] PF MG
MAGNESIUM ION[1 atoms]
Y 100.0
/26.5
1
/1
SELB_ECOLI Selenocysteine-specific elongation factor
5mi8[1] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/33.2
1
/1
EFTU1_ECOHS Elongation factor Tu 1
5uym[1] KK MG
MAGNESIUM ION[1 atoms]
HB 0.0
/33.3
1
/1
EFTU1_ECOLI Elongation factor Tu 2
4iw3[1] K MN
MANGANESE (II) ION[1 atoms]
C 0.0
/35.3
1
/1
EFTU1_PSEPK Elongation factor Tu-A
5izm[2] C MN
MANGANESE (II) ION[1 atoms]
A 33.3
/26.4
3
/3
SELB_HUMAN Selenocysteine-specific elongation factor
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5it7[1] A 25S ribosomal RNA EC 100.0
/44.1
6
/23
W7R097_YEASX Eft2p
1ob2[1] C beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose A 22.2
/33.3
9
/12
EFTU2_ECOLI ELONGATION FACTOR TU
5w75[3] E beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose B 55.6
/37.6
9
/9
EFTU_THENN Elongation factor Tu
5w75[1] G beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose C 50.0
/36.4
4
/4
EFTU_THENN Elongation factor Tu
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4c0s[2] B EF1A2_RABIT ELONGATION FACTOR 1-ALPHA 2[442 aa] A 100.0
/92.4
42
/42
EF1A2_RABIT ELONGATION FACTOR 1-ALPHA 2
1tui[9] B EFTU_THEAQ ELONGATION FACTOR TU[397 aa] A 57.1
/38.4
7
/7
EFTU_THEAQ ELONGATION FACTOR TU
1tui[1] A EFTU_THEAQ ELONGATION FACTOR TU[397 aa] B 75.0
/38.4
4
/4
EFTU_THEAQ ELONGATION FACTOR TU
1tui[1] C EFTU_THEAQ ELONGATION FACTOR TU[397 aa] B 42.9
/38.4
7
/7
EFTU_THEAQ ELONGATION FACTOR TU
1tui[1] B EFTU_THEAQ ELONGATION FACTOR TU[397 aa] C 42.9
/38.4
7
/7
EFTU_THEAQ ELONGATION FACTOR TU
2qmu[2] A IF2G_SULSO Translation initiation factor 2 gamma subunit[414 .. A 33.3
/37.9
6
/12
IF2G_SULSO Translation initiation factor 2 gamma subunit
1d2e[1] C EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)[397 aa] A 25.0
/37.0
4
/5
EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)
1d2e[4] D EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)[397 aa] A 0.0
/37.0
5
/8
EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)
1d2e[1] A EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)[397 aa] C 16.7
/37.0
6
/6
EFTU_BOVIN ELONGATION FACTOR TU (EF-TU)
6htw[1] A Elongation Factor Tu[356 aa] B 33.3
/34.8
12
/12
Elongation Factor Tu
6htw[1] B Elongation Factor Tu[385 aa] A 45.5
/34.5
11
/11
Elongation Factor Tu
7bbn[1] B Elongation Factor Tu[366 aa] A 8.3
/34.0
12
/12
Elongation Factor Tu
7bbn[1] A Elongation Factor Tu[361 aa] B 33.3
/33.9
12
/12
Elongation Factor Tu
3agp[4] A EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER.. A 0.0
/33.4
1
/23
EFTS_ECO57 EFTU_ECO57 Q8LTE0_BPQBE Elongation factor Ts, Elongation factor Tu, LINKER..
3mmp[2] C EFTS_ECOLI EFTU2_ECOLI Elongation factor Tu 2, Elongation factor Ts[643 a.. A 0.0
/33.6
4
/4
EFTS_ECOLI EFTU2_ECOLI Elongation factor Tu 2, Elongation factor Ts
1dg1[2] B EFTU_ECOLI ELONGATION FACTOR TU[385 aa] A 37.5
/33.5
8
/9
EFTU_ECOLI ELONGATION FACTOR TU
1efu[2] C EFTU_ECOLI ELONGATION FACTOR TU[364 aa] A 0.0
/33.5
7
/7
EFTU_ECOLI ELONGATION FACTOR TU
2hdn[6] D EFTU_ECOLI Elongation factor EF-Tu[335 aa] B 38.5
/33.4
26
/26
EFTU_ECOLI Elongation factor EF-Tu
3vr1[4] B RF3_DESVM Peptide chain release factor 3[516 aa] A 25.0
/31.3
16
/18
RF3_DESVM Peptide chain release factor 3
5a9y[2] A B7MHF0_ECO45 GTP-BINDING PROTEIN[562 aa] A 33.3
/30.9
9
/30
B7MHF0_ECO45 GTP-BINDING PROTEIN
3tr5[2] B RF3_COXBU Peptide chain release factor 3[508 aa] A 25.0
/29.3
4
/26
RF3_COXBU Peptide chain release factor 3
5i4q[2] C J7R9V6_ECOLX Elongation factor Tu[186 aa] C 0.0
/29.1
1
/1
J7R9V6_ECOLX Elongation factor Tu
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
462 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1b23[1] G SO4
SULFATE ION[5 atoms]
B 0.0
/38.2
3
/3
EFTU_THEAQ ELONGATION FACTOR TU
1b23[18] H SO4
SULFATE ION[5 atoms]
B 25.0
/38.2
4
/4
EFTU_THEAQ ELONGATION FACTOR TU
3vmf[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/55.7
3
/3
EF1A_AERPE Elongation factor 1-alpha
4ac9[12] I SO4
SULFATE ION[5 atoms]
B 50.0
/35.5
2
/2
Q8J307_METMI MJ0495-LIKE PROTEIN
4ac9[4] J SO4
SULFATE ION[5 atoms]
B 50.0
/35.5
2
/2
Q8J307_METMI MJ0495-LIKE PROTEIN
4ac9[3] O SO4
SULFATE ION[5 atoms]
C 0.0
/35.0
2
/6
Q8J307_METMI MJ0495-LIKE PROTEIN
4ac9[3] P SO4
SULFATE ION[5 atoms]
C 0.0
/35.0
2
/3
Q8J307_METMI MJ0495-LIKE PROTEIN
4g5g[3] F SO4
SULFATE ION[5 atoms]
A 0.0
/33.3
1
/1
EFTU1_ECOLI Elongation factor Tu 1
4h9g[1] F SO4
SULFATE ION[5 atoms]
A 50.0
/38.5
4
/4
EFTU1_THETH Elongation factor Tu-A
4h9g[2] G SO4
SULFATE ION[5 atoms]
A 100.0
/38.5
2
/2
EFTU1_THETH Elongation factor Tu-A
4h9g[10] I SO4
SULFATE ION[5 atoms]
A 0.0
/38.5
1
/1
EFTU1_THETH Elongation factor Tu-A
4h9g[10] J SO4
SULFATE ION[5 atoms]
A 33.3
/38.5
3
/3
EFTU1_THETH Elongation factor Tu-A
4h9g[1] K SO4
SULFATE ION[5 atoms]
A 50.0
/38.5
2
/2
EFTU1_THETH Elongation factor Tu-A
4h9g[8] L SO4
SULFATE ION[5 atoms]
A 0.0
/38.5
3
/3
EFTU1_THETH Elongation factor Tu-A
4lbv[7] H SO4
SULFATE ION[5 atoms]
A 50.0
/38.5
2
/2
EFTU1_THETH Elongation factor Tu-A
4lbv[8] I SO4
SULFATE ION[5 atoms]
A 100.0
/38.5
1
/1
EFTU1_THETH Elongation factor Tu-A
4lbv[9] L SO4
SULFATE ION[5 atoms]
A 100.0
/38.5
1
/1
EFTU1_THETH Elongation factor Tu-A
4lbv[8] M SO4
SULFATE ION[5 atoms]
A 50.0
/38.5
4
/4
EFTU1_THETH Elongation factor Tu-A
4m2l[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/36.1
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4q7j[3] I SO4
SULFATE ION[5 atoms]
B 33.3
/33.5
3
/3
EFTU1_ECOLI Elongation factor Tu 1
4q7j[3] J SO4
SULFATE ION[5 atoms]
B 0.0
/33.5
2
/2
EFTU1_ECOLI Elongation factor Tu 1
4zu9[1] D SO4
SULFATE ION[5 atoms]
A 0.0
/33.7
3
/3
O67141_AQUAE Elongation factor SelB
5i4q[2] E SO4
SULFATE ION[5 atoms]
C 0.0
/29.1
2
/2
J7R9V6_ECOLX Elongation factor Tu
5w75[6] K SO4
SULFATE ION[5 atoms]
A 0.0
/36.7
4
/4
EFTU_THENN Elongation factor Tu
5w75[4] L SO4
SULFATE ION[5 atoms]
A 66.7
/36.7
3
/3
EFTU_THENN Elongation factor Tu
5w75[3] T SO4
SULFATE ION[5 atoms]
B 0.0
/37.6
1
/1
EFTU_THENN Elongation factor Tu
5w75[2] Z SO4
SULFATE ION[5 atoms]
C 33.3
/36.4
3
/3
EFTU_THENN Elongation factor Tu
5w75[1] HA SO4
SULFATE ION[5 atoms]
D 33.3
/36.4
3
/3
EFTU_THENN Elongation factor Tu
5w76[1] C SO4
SULFATE ION[5 atoms]
A 0.0
/36.1
3
/5
Ancestral Elogation Factor N153
6eze[1] H SO4
SULFATE ION[5 atoms]
A 25.0
/33.5
4
/4
EFTU2_ECOLI Elongation factor Tu 2
6ra9[7] H SO4
SULFATE ION[5 atoms]
A 100.0
/92.4
3
/3
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[2] I SO4
SULFATE ION[5 atoms]
A 100.0
/92.4
5
/5
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[2] K SO4
SULFATE ION[5 atoms]
A 75.0
/92.4
4
/4
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] W SO4
SULFATE ION[5 atoms]
B 75.0
/92.6
4
/4
EF1A2_RABIT Elongation factor 1-alpha 2
4p3y[1] E GOL
GLYCEROL[6 atoms]
A 25.0
/33.5
4
/4
EFTU1_ECOLI Elongation factor Tu 1
4pc1[3] F GOL
GLYCEROL[6 atoms]
A 50.0
/33.7
4
/4
B1X6I9_ECODH Elongation factor Tu
4pc6[1] H GOL
GLYCEROL[6 atoms]
C 14.3
/34.1
7
/7
B1X6I9_ECODH Elongation factor Tu
5opd[1] U GOL
GLYCEROL[6 atoms]
A 66.7
/37.4
3
/6
EFTU1_ECOHS Elongation factor Tu 1
6eze[1] F GOL
GLYCEROL[6 atoms]
A 20.0
/33.5
5
/5
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] G GOL
GLYCEROL[6 atoms]
A 0.0
/33.5
1
/2
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] O GOL
GLYCEROL[6 atoms]
B 0.0
/33.5
2
/2
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] P GOL
GLYCEROL[6 atoms]
B 50.0
/33.5
6
/6
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] Q GOL
GLYCEROL[6 atoms]
B 0.0
/33.5
2
/2
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] R GOL
GLYCEROL[6 atoms]
B 0.0
/33.5
1
/1
EFTU2_ECOLI Elongation factor Tu 2
6ra9[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/92.4
4
/4
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/92.4
1
/1
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] R GOL
GLYCEROL[6 atoms]
A 100.0
/92.4
3
/3
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] O GOL
GLYCEROL[6 atoms]
B 50.0
/92.6
2
/2
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] P GOL
GLYCEROL[6 atoms]
B 75.0
/92.6
8
/8
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] Q GOL
GLYCEROL[6 atoms]
B 85.7
/92.6
7
/7
EF1A2_RABIT Elongation factor 1-alpha 2
6ra9[1] R GOL
GLYCEROL[6 atoms]
B 100.0
/92.6
2
/2
EF1A2_RABIT Elongation factor 1-alpha 2
1b23[1] E CYS
CYSTEINE[6 atoms]
B 71.4
/38.2
7
/7
EFTU_THEAQ ELONGATION FACTOR TU
4m4s[1] AA FMT
FORMIC ACID[3 atoms]
A 100.0
/35.4
1
/5
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[16] B FMT
FORMIC ACID[3 atoms]
A 60.0
/35.4
5
/5
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[3] BA FMT
FORMIC ACID[3 atoms]
A 33.3
/35.4
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[1] C FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
2
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[2] CA FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
3
/6
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[1] D FMT
FORMIC ACID[3 atoms]
A 50.0
/35.4
2
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[2] H FMT
FORMIC ACID[3 atoms]
A 50.0
/35.4
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[1] J FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
2
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[6] M FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[4] O FMT
FORMIC ACID[3 atoms]
A 50.0
/35.4
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[7] U FMT
FORMIC ACID[3 atoms]
A 50.0
/35.4
2
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[5] V FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[1] X FMT
FORMIC ACID[3 atoms]
A 50.0
/35.4
4
/5
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[1] Y FMT
FORMIC ACID[3 atoms]
A 0.0
/35.4
2
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m4s[4] Z FMT
FORMIC ACID[3 atoms]
A 33.3
/35.4
3
/6
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] F FMT
FORMIC ACID[3 atoms]
A 0.0
/38.5
3
/6
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] G FMT
FORMIC ACID[3 atoms]
A 33.3
/38.5
3
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[2] L FMT
FORMIC ACID[3 atoms]
A 33.3
/38.5
3
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] O FMT
FORMIC ACID[3 atoms]
A 0.0
/38.5
4
/5
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[6] R FMT
FORMIC ACID[3 atoms]
A 0.0
/38.5
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] V FMT
FORMIC ACID[3 atoms]
A 100.0
/38.5
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] W FMT
FORMIC ACID[3 atoms]
A 0.0
/38.5
1
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] X FMT
FORMIC ACID[3 atoms]
A 33.3
/38.5
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m53[1] Y FMT
FORMIC ACID[3 atoms]
A 0.0
/38.5
3
/8
IF2G_SULSO Translation initiation factor 2 subunit gamma
4nbs[1] R FMT
FORMIC ACID[3 atoms]
A 0.0
/37.3
4
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4qfm[1] P FMT
FORMIC ACID[3 atoms]
A 0.0
/37.3
1
/1
IF2G_SULSO Translation initiation factor 2 subunit gamma
4qfm[2] T FMT
FORMIC ACID[3 atoms]
A 100.0
/37.3
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4rjl[2] V FMT
FORMIC ACID[3 atoms]
A 50.0
/37.9
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
6mij[1] D FMT
FORMIC ACID[3 atoms]
A 0.0
/33.5
2
/2
N9JNN0_ACIB2 Elongation factor Tu
6mij[1] F FMT
FORMIC ACID[3 atoms]
A 25.0
/33.5
4
/4
N9JNN0_ACIB2 Elongation factor Tu
6mij[1] G FMT
FORMIC ACID[3 atoms]
A 40.0
/33.5
5
/5
N9JNN0_ACIB2 Elongation factor Tu
6mij[1] I FMT
FORMIC ACID[3 atoms]
A 50.0
/33.5
6
/6
N9JNN0_ACIB2 Elongation factor Tu
6mij[1] K FMT
FORMIC ACID[3 atoms]
A 25.0
/33.5
4
/4
N9JNN0_ACIB2 Elongation factor Tu
6r8s[1] H FMT
FORMIC ACID[3 atoms]
A 100.0
/36.8
1
/3
A0A0E3JTX3_SACSO Translation initiation factor 2 subunit gamma
4zke[1] E PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/28.9
1
/4
SKI7_YEAST Superkiller protein 7
5o8w[2] D PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/81.7
2
/2
EF1A_YEAST Elongation factor 1-alpha
5o8w[1] F PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/81.7
4
/4
EF1A_YEAST Elongation factor 1-alpha
5w76[1] D PGE
TRIETHYLENE GLYCOL[10 atoms]
A 33.3
/36.1
3
/4
Ancestral Elogation Factor N153
4j0q[3] H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 50.0
/36.1
4
/4
EFTU1_PSEPK Elongation factor Tu-A
4j0q[4] I MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 66.7
/36.1
6
/6
EFTU1_PSEPK Elongation factor Tu-A
4j0q[1] J MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]
A 0.0
/36.1
2
/2
EFTU1_PSEPK Elongation factor Tu-A
2qmu[2] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/37.9
2
/2
IF2G_SULSO Translation initiation factor 2 gamma subunit
3i1f[1] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/37.9
2
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
3i1f[1] E PO4
PHOSPHATE ION[5 atoms]
A 0.0
/37.9
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m2l[1] G PO4
PHOSPHATE ION[5 atoms]
A 100.0
/36.1
2
/2
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m2l[1] H PO4
PHOSPHATE ION[5 atoms]
A 0.0
/36.1
3
/3
IF2G_SULSO Translation initiation factor 2 subunit gamma
4m2l[1] I PO4
PHOSPHATE ION[5 atoms]
A 0.0
/36.1
4
/4
IF2G_SULSO Translation initiation factor 2 subunit gamma
4pc1[2] E PO4
PHOSPHATE ION[5 atoms]
A 71.4
/33.7
7
/7
B1X6I9_ECODH Elongation factor Tu
4rd3[1] B PO4
PHOSPHATE ION[5 atoms]
A 62.5
/37.3
8
/8
IF2G_SULSO Translation initiation factor 2 subunit gamma
4zkd[1] B PO4
PHOSPHATE ION[5 atoms]
A 33.3
/28.9
9
/9
SKI7_YEAST Superkiller protein 7
7pjv[2] SP PO4
PHOSPHATE ION[5 atoms]
EB 83.3
/33.8
6
/6
EFG_ECOLI Elongation factor G
2hcj[1] J GLV
GLYOXYLIC ACID[5 atoms]
B 0.0
/33.5
2
/2
EFTU_ECOLI Protein chain elongation factor EF-Tu
2c77[1] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 57.1
/38.5
7
/7
EFTU2_THET8 ELONGATION FACTOR TU-B
5w76[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 20.0
/36.1
5
/5
Ancestral Elogation Factor N153
5w76[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/36.1
5
/5
Ancestral Elogation Factor N153
6eze[1] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 0.0
/33.5
7
/7
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 25.0
/33.5
4
/4
EFTU2_ECOLI Elongation factor Tu 2
6eze[1] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 80.0
/33.5
5
/5
EFTU2_ECOLI Elongation factor Tu 2
1d8t[3] G ACT
ACETATE ION[4 atoms]
A 25.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] H ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] J ACT
ACETATE ION[4 atoms]
A 50.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] K ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
3
/3
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] L ACT
ACETATE ION[4 atoms]
A 50.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] M ACT
ACETATE ION[4 atoms]
A 25.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[3] N ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
3
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[2] O ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
2
/2
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] P ACT
ACETATE ION[4 atoms]
A 50.0
/33.3
2
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] S ACT
ACETATE ION[4 atoms]
A 100.0
/33.3
2
/2
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] T ACT
ACETATE ION[4 atoms]
A 20.0
/33.3
5
/5
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[2] U ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
6
/6
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[2] V ACT
ACETATE ION[4 atoms]
A 0.0
/33.3
3
/3
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[2] W ACT
ACETATE ION[4 atoms]
A 33.3
/33.3
6
/6
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] X ACT
ACETATE ION[4 atoms]
A 50.0
/33.3
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[2] Y ACT
ACETATE ION[4 atoms]
A 60.0
/33.3
5
/7
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] DA ACT
ACETATE ION[4 atoms]
B 0.0
/33.5
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] FA ACT
ACETATE ION[4 atoms]
B 25.0
/33.5
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] HA ACT
ACETATE ION[4 atoms]
B 25.0
/33.5
4
/4
EFTU_ECOLI ELONGATION FACTOR TU
1d8t[1] JA ACT
ACETATE ION[4 atoms]
B 0.0
/33.5
1
/2
EFTU_ECOLI ELONGATION FACTOR TU
5mi8[1] F