Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
869316	76	13	P59637(VEMP_SARS)	RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ;
QUERYSEQ	MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV

UniProt Feature Tables [P59637(VEMP_SARS)]

76
	region	name	description
	1-76	CHAIN	/note="Envelope small membrane protein" /id="PRO_0000106074"
	1-16	TOPO_DOM	/note="Virion surface"
	17-37	TRANSMEM	/note="Helical"
	38-76	TOPO_DOM	/note="Intravirion"

MONOMER
76
	pdb_id	a1	identity[%]2	description
	2mm4	A	94.8	VEMP_CVHSA Envelope small membrane protein
	1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.

HETERO
76	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7ntj[2]	A	MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa]	B	100.0 /100.0	4 /4	VEMP_SARS Envelope small membrane protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
76	pdb_id	contact mol		homologue
		a3	description	a4	identity[%]5	Ncon6	description
	7k3g[10]	B	VEMP_SARS2 Envelope small membrane protein[31 aa]	A	100.0 /100.0	12 /12	VEMP_SARS2 Envelope small membrane protein
	5x29[5]	B	VEMP_CVHSA Envelope small membrane protein[58 aa]	A	100.0 /94.8	9 /9	VEMP_CVHSA Envelope small membrane protein
	5x29[5]	E	VEMP_CVHSA Envelope small membrane protein[58 aa]	A	100.0 /94.8	6 /6	VEMP_CVHSA Envelope small membrane protein
	3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.