Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
869316 76 13 P59637(VEMP_SARS) RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ;
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59637(VEMP_SARS)]

76
region name description
1-76 CHAIN /note="Envelope small membrane protein" /id="PRO_0000106074"
1-16 TOPO_DOM /note="Virion surface"
17-37 TRANSMEM /note="Helical"
38-76 TOPO_DOM /note="Intravirion"

MONOMER
76
pdb_id a1 identity[%]2 description
2mm4 A 94.8 VEMP_CVHSA Envelope small membrane protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
76 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7ntj[2] A MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] B 100.0
/100.0
4
/4
VEMP_SARS Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
76 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7k3g[10] B VEMP_SARS2 Envelope small membrane protein[31 aa] A 100.0
/100.0
12
/12
VEMP_SARS2 Envelope small membrane protein
5x29[5] B VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/94.8
9
/9
VEMP_CVHSA Envelope small membrane protein
5x29[5] E VEMP_CVHSA Envelope small membrane protein[58 aa] A 100.0
/94.8
6
/6
VEMP_CVHSA Envelope small membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.