#WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/20155.bltA' #WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/20155.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
20155 76 0 P59637(VEMP_SARS) RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ;
QUERYSEQ
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59637(VEMP_SARS)]

76
region name description
1-76 CHAIN /note="Envelope small membrane protein" /id="PRO_0000106074"
1-16 TOPO_DOM /note="Virion surface"
17-37 TRANSMEM /note="Helical"
38-76 TOPO_DOM /note="Intravirion"

No homologue is found in PDB.

Please check [SiteTable] for homologues.