Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4027428 98 20 P59636(ORF9B_SARS) RecName: Full=ORF9b protein;AltName: Full=Accessory protein 9b;AltName: Full=ORF-9b;AltName: Full=Protein 9b;
QUERYSEQ
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59636(ORF9B_SARS)]

98
region name description
1-98 CHAIN /note="ORF9b protein" /id="PRO_0000106137"
9-98 DOMAIN /note="9b"
1-4 DISORDER predicted by DISOPRED

MONOMER
98
pdb_id a1 identity[%]2 description
2cme B 98.7 Y5_CVHSA HYPOTHETICAL PROTEIN 5
7ye8 B 77.3 ORF9B_SARS2 ORF9b protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
98 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cme[6] B Y5_CVHSA HYPOTHETICAL PROTEIN 5[79 aa] A 96.9
/98.7
32
/32
Y5_CVHSA HYPOTHETICAL PROTEIN 5
7dhg[2] A TOM70_HUMAN Mitochondrial import receptor subunit TOM70[470 aa.. B 75.9
/75.0
29
/29
ORF9B_SARS2 ORF9b protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
98 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cme[3] I D10
DECANE[10 atoms]
A 100.0
/98.7
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[1] I D10
DECANE[10 atoms]
B 100.0
/98.7
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[2] J D10
DECANE[10 atoms]
C 100.0
/98.7
3
/3
Y5_CVHSA HYPOTHETICAL PROTEIN 5
2cme[1] K D10
DECANE[10 atoms]
E 100.0
/98.7
2
/2
Y5_CVHSA HYPOTHETICAL PROTEIN 5
6z4u[1] C 15P
POLYETHYLENE GLYCOL (N=34)[14 atoms]
B 100.0
/82.4
7
/7
ORF9B_SARS2 Protein 9b
7ye7[5] F OCT
N-OCTANE[8 atoms]
C 100.0
/83.1
3
/3
ORF9B_SARS2 ORF9b protein
7ye7[1] F OCT
N-OCTANE[8 atoms]
D 100.0
/82.2
1
/1
ORF9B_SARS2 ORF9b protein
7ye7[1] E DD9
nonane[9 atoms]
A 100.0
/82.4
1
/1
ORF9B_SARS2 ORF9b protein
7ye7[1] E DD9
nonane[9 atoms]
B 100.0
/79.2
2
/2
ORF9B_SARS2 ORF9b protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
98 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cme[2] D Y5_CVHSA HYPOTHETICAL PROTEIN 5[76 aa] C 96.9
/98.7
32
/32
Y5_CVHSA HYPOTHETICAL PROTEIN 5
7ye7[1] B ORF9B_SARS2 ORF9b protein[78 aa] A 81.2
/82.4
32
/32
ORF9B_SARS2 ORF9b protein
6z4u[8] B ORF9B_SARS2 Protein 9b[82 aa] A 78.8
/77.4
33
/33
ORF9B_SARS2 Protein 9b
7ye8[1] B ORF9B_SARS2 ORF9b protein[88 aa] A 79.4
/80.8
34
/34
ORF9B_SARS2 ORF9b protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.