#WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/23361.bltA' #WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/23361.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
23361 122 0 P59635(NS7A_SARS) RecName: Full=ORF7a protein;AltName: Full=Accessory protein 7a;AltName: Full=Protein U122;AltName: Full=Protein X4;Flags: Precursor;
QUERYSEQ
MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59635(NS7A_SARS)]

122
region name description
1-15 SIGNAL
16-122 CHAIN /note="ORF7a protein" /id="PRO_0000037435"
16-96 TOPO_DOM /note="Virion surface"
97-117 TRANSMEM /note="Helical"
118-122 TOPO_DOM /note="Intravirion"
16-81 DOMAIN /note="X4e"

No homologue is found in PDB.

Please check [SiteTable] for homologues.