#WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/16199.bltA' #WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/16199.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
16199 274 0 P59632(AP3A_SARS) RecName: Full=ORF3a protein;AltName: Full=Accessory protein 3a;AltName: Full=Protein 3a;AltName: Full=Protein U274;AltName: Full=Protein X1;
QUERYSEQ
MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFGWLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGMEAQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWH
THNYDYCIPYNSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59632(AP3A_SARS)]

274
region name description
1-274 CHAIN /note="ORF3a protein" /id="PRO_0000106131"
1-34 TOPO_DOM /note="Extracellular"
35-55 TRANSMEM /note="Helical"
56-78 TOPO_DOM /note="Cytoplasmic"
79-99 TRANSMEM /note="Helical"
100-104 TOPO_DOM /note="Extracellular"
105-125 TRANSMEM /note="Helical"
126-274 TOPO_DOM /note="Cytoplasmic"
83-86 COMPBIAS /note="Poly-Leu"
267-270 COMPBIAS /note="Poly-Thr"

No homologue is found in PDB.

Please check [SiteTable] for homologues.