HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

4088214

422

270

P59595(NCAP_SARS)

RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;

QUERYSEQ

MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR
NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59595(NCAP_SARS)]

422
	region	name	description
	1-422	CHAIN	/note="Nucleoprotein" /id="PRO_0000106003"
	49-176	DOMAIN	/note="CoV N NTD"
	248-365	DOMAIN	/note="CoV N CTD"
	1-52	REGION	/note="Disordered"
	42-187	REGION	/note="RNA-binding"
	45-181	REGION	/note="RNA-binding"
	167-214	REGION	/note="Disordered"
	177-204	REGION	/note="SR region"
	234-287	REGION	/note="Disordered"
	259-362	REGION	/note="Dimerization"
	362-422	REGION	/note="Disordered"
	1-35	COMPBIAS	/note="Polar residues"
	178-209	COMPBIAS	/note="Polar residues"
	234-252	COMPBIAS	/note="Polar residues"
	265-287	COMPBIAS	/note="Polar residues"
	363-383	COMPBIAS	/note="Basic and acidic residues"
	404-422	COMPBIAS	/note="Polar residues"
	93-93	BINDING	/ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
	108-108	BINDING	/ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
	150-150	BINDING	/ligand="RNA" /ligand_id="ChEBI:CHEBI:33697"
	1-422	DISORDER	predicted by DISOPRED

MONOMER

422

pdb_id a¹ identity[%]² description

8fg2 B 91.2 NCAP_SARS2 Nucleoprotein

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7n0i[8] H Single-domain antibody E2[136 aa] A 90.0
/95.8 10
/10 NCAP_SARS2 Nucleoprotein

7ylb[8] C NC2[84 aa] A 92.3
/95.4 13
/13 NCAP_SARS2 Nucleoprotein

7yld[1] H NN2[71 aa] C 91.7
/93.5 12
/12 NCAP_SARS2 Nucleoprotein

7yld[3] E NN2[84 aa] A 91.7
/92.9 12
/12 NCAP_SARS2 Nucleoprotein

7r98[3] D Nanobody B6[129 aa] A 100.0
/92.4 14
/14 NCAP_SARS2 Nucleoprotein

7n3d[1] A S24-1564 Fab heavy chain[223 aa] C 100.0
/92.7 12
/12 NCAP_SARS2 Nucleoprotein

7n3d[1] B S24-1564 Fab light chain[213 aa] C 87.5
/92.7 8
/8 NCAP_SARS2 Nucleoprotein

7sue[2] A S24-188 Fab Light chain[212 aa] E 100.0
/92.2 5
/5 NCAP_SARS2 Nucleoprotein

7sue[2] B S24-188 Fab Heavy chain[227 aa] E 100.0
/92.2 8
/8 NCAP_SARS2 Nucleoprotein

7sue[2] G S24-188 Fab Light chain[109 aa] K 100.0
/93.0 5
/5 NCAP_SARS2 Nucleoprotein

7sue[2] H S24-188 Fab Heavy chain[129 aa] K 100.0
/93.0 7
/7 NCAP_SARS2 Nucleoprotein

7n3c[1] A S24-202 Fab heavy chain[226 aa] C 100.0
/92.1 11
/11 NCAP_SARS2 Nucleoprotein

7n0r[2] C Single-domain antibody C2[123 aa] A 88.2
/92.1 17
/17 NCAP_SARS2 Nucleoprotein

7n3c[2] B S24-202 Fab light chain[214 aa] C 80.0
/92.1 5
/5 NCAP_SARS2 Nucleoprotein

7str[1] B Fab S24-1063, Heavy chain[222 aa] C 100.0
/92.1 11
/11 NCAP_SARS2 Nucleoprotein

7cr5[1] B monoclonal antibody chain H[216 aa] A 100.0
/92.0 7
/7 NCAP_SARS2 Nucleoprotein

7cr5[1] C monoclonal antibody chain L[213 aa] A 93.3
/92.0 15
/15 NCAP_SARS2 Nucleoprotein

7pku[2] A A0A6M4N019_SARS2 3C-like proteinase[96 aa] B 94.4
/89.0 18
/18 A0A6G9KDV1_SARS2 Nucleoprotein

7wzo[1] C R1A_SARS2 nsp3[110 aa] A 100.0
/92.0 10
/10 NCAP_SARS2 Nucleoprotein

7sts[2] E Fab S24-1379, heavy chain[210 aa] C 83.3
/92.8 6
/6 NCAP_SARS2 Nucleoprotein

7sts[2] F Fab S24-1379, light chain[212 aa] C 83.3
/92.8 6
/6 NCAP_SARS2 Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7act[1] B ssRNA A 85.7
/92.7 28
/28 NCAP_SARS2 Nucleoprotein

7acs[1] B RNA (5'-R(P*CP*AP*CP*UP*GP*AP*C)-3') A 60.0
/92.0 5
/5 NCAP_SARS2 Nucleoprotein

7xwz[1] C RNA (5'-R(*CP*AP*CP*UP*GP*AP*C)-3') A 50.0
/92.0 2
/2 NCAP_SARS2 Nucleoprotein

7acs[1] C RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 81.8
/92.0 11
/11 NCAP_SARS2 Nucleoprotein

7xwz[2] D RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/92.0 8
/8 NCAP_SARS2 Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] C 100.0
/95.5 4
/4 NCAP_SARS2 Nucleoprotein

7o35[3] E GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms] D 100.0
/95.4 4
/4 NCAP_SARS2 Nucleoprotein

4lm9[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 80.0
/48.8 10
/14 Q6SA23_CVHOC Nucleoprotein

7xxk[3] H 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[3] I 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7uxz[1] G GKP
(2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-.. A 100.0
/95.4 8
/8 NCAP_SARS2 Nucleoprotein

7xxk[1] R GUN
GUANINE[11 atoms] C 100.0
/95.3 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] R GUN
GUANINE[11 atoms] D 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[1] FA GMP
GUANOSINE[20 atoms] E 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] FA GMP
GUANOSINE[20 atoms] F 100.0
/95.3 3
/3 NCAP_SARS2 Nucleoprotein

8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. A 100.0
/92.1 2
/2 NCAP_SARS2 Nucleoprotein

8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. B 100.0
/92.2 2
/2 NCAP_SARS2 Nucleoprotein

8j6x[1] E U2H
~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y.. D 100.0
/92.1 4
/4 NCAP_SARS2 Nucleoprotein

6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. B 83.3
/60.3 6
/6 A0A0D3MU65_9BETC Nucleoprotein

6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. D 57.1
/62.2 7
/7 A0A0D3MU65_9BETC Nucleoprotein

8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. A 66.7
/92.1 3
/3 NCAP_SARS2 Nucleoprotein

8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. B 100.0
/92.2 1
/1 NCAP_SARS2 Nucleoprotein

8iv3[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. D 100.0
/92.1 4
/4 NCAP_SARS2 Nucleoprotein

6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. A 75.0
/60.5 4
/4 A0A0D3MU65_9BETC Nucleoprotein

6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. C 50.0
/62.1 4
/4 A0A0D3MU65_9BETC Nucleoprotein

7dyd[1] E EY3
5-propan-2-yloxy-1H-indole[13 atoms] B 100.0
/59.1 1
/1 A0A2I2MQD0_9BETC Nucleoprotein

7dyd[1] E EY3
5-propan-2-yloxy-1H-indole[13 atoms] D 83.3
/61.8 6
/6 A0A2I2MQD0_9BETC Nucleoprotein

6lz8[1] E EY9
5-(2-methoxyethoxy)-1H-indole[14 atoms] C 100.0
/59.1 2
/2 A0A2I2MQD0_9BETC Nucleoprotein

6lz8[1] E EY9
5-(2-methoxyethoxy)-1H-indole[14 atoms] D 100.0
/61.6 3
/3 A0A2I2MQD0_9BETC Nucleoprotein

6lnn[1] E EJC
5-propoxy-1H-indole[13 atoms] B 100.0
/60.0 1
/1 A0A2I2MQD0_9BETC Nucleoprotein

6lnn[1] E EJC
5-propoxy-1H-indole[13 atoms] D 100.0
/61.3 5
/5 A0A2I2MQD0_9BETC Nucleoprotein

6lz6[1] E EY6
5-(2-fluoranylethoxy)-1H-indole[13 atoms] B 100.0
/59.1 1
/1 A0A2I2MQD0_9BETC Nucleoprotein

6lz6[1] E EY6
5-(2-fluoranylethoxy)-1H-indole[13 atoms] D 100.0
/60.9 7
/7 A0A2I2MQD0_9BETC Nucleoprotein

4li4[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms] A 80.0
/49.2 10
/14 Q6SA23_CVHOC Nucleoprotein

4lm7[1] B U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] A 80.0
/49.2 10
/14 Q6SA23_CVHOC Nucleoprotein

4lmt[1] B CQD
6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli.. A 83.3
/48.8 6
/10 Q6SA23_CVHOC Nucleoprotein

4lmc[1] B C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms] A 88.9
/48.8 9
/13 Q6SA23_CVHOC Nucleoprotein

4kxj[1] B P34
N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH.. A 50.0
/48.4 6
/10 Q6SA23_CVHOC Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7n0i[1] N MG
MAGNESIUM ION[1 atoms] D 100.0
/95.8 3
/3 NCAP_SARS2 Nucleoprotein

6g13[2] I CL
CHLORIDE ION[1 atoms] B 50.0
/54.2 2
/2 A0A0D3MU51_9BETC Nucleoprotein

6vyo[13] F CL
CHLORIDE ION[1 atoms] A 100.0
/91.9 1
/1 NCAP_SARS2 Nucleoprotein

6vyo[4] I CL
CHLORIDE ION[1 atoms] A 66.7
/91.9 3
/3 NCAP_SARS2 Nucleoprotein

6wji[6] G CL
CHLORIDE ION[1 atoms] A 100.0
/95.4 1
/1 NCAP_SARS2 Nucleoprotein

6wji[4] H CL
CHLORIDE ION[1 atoms] A 100.0
/95.4 1
/1 NCAP_SARS2 Nucleoprotein

7n3d[1] O CL
CHLORIDE ION[1 atoms] C 100.0
/92.7 2
/2 NCAP_SARS2 Nucleoprotein

7n3d[1] P CL
CHLORIDE ION[1 atoms] C 100.0
/92.7 2
/2 NCAP_SARS2 Nucleoprotein

7uxz[1] L CL
CHLORIDE ION[1 atoms] E 100.0
/95.4 1
/1 NCAP_SARS2 Nucleoprotein

7xxk[1] O CL
CHLORIDE ION[1 atoms] B 100.0
/95.3 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] P CL
CHLORIDE ION[1 atoms] B 100.0
/95.3 1
/1 NCAP_SARS2 Nucleoprotein

7xxk[1] V CL
CHLORIDE ION[1 atoms] C 100.0
/95.3 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[1] X CL
CHLORIDE ION[1 atoms] C 100.0
/95.3 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[2] Y CL
CHLORIDE ION[1 atoms] C 100.0
/95.3 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[1] EA CL
CHLORIDE ION[1 atoms] E 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] IA CL
CHLORIDE ION[1 atoms] F 100.0
/95.3 1
/1 NCAP_SARS2 Nucleoprotein

7uxz[3] J NA
SODIUM ION[1 atoms] A 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[5] J K
POTASSIUM ION[1 atoms] A 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[2] K K
POTASSIUM ION[1 atoms] A 66.7
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] L K
POTASSIUM ION[1 atoms] A 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7xxk[1] M K
POTASSIUM ION[1 atoms] A 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7xxk[5] N K
POTASSIUM ION[1 atoms] A 100.0
/95.4 1
/1 NCAP_SARS2 Nucleoprotein

6vyo[12] H ZN
ZINC ION[1 atoms] A 66.7
/91.9 3
/3 NCAP_SARS2 Nucleoprotein

6vyo[8] J ZN
ZINC ION[1 atoms] A 100.0
/91.9 1
/1 NCAP_SARS2 Nucleoprotein

7cr5[1] D ZN
ZINC ION[1 atoms] A 100.0
/92.0 1
/1 NCAP_SARS2 Nucleoprotein

7xx1[4] J ZN
ZINC ION[1 atoms] A 100.0
/92.0 1
/1 NCAP_SARS2 Nucleoprotein

7n3c[1] T IOD
IODIDE ION[1 atoms] C 66.7
/92.1 3
/3 NCAP_SARS2 Nucleoprotein

7n3c[1] U IOD
IODIDE ION[1 atoms] C 100.0
/92.1 2
/2 NCAP_SARS2 Nucleoprotein

7n3c[1] V IOD
IODIDE ION[1 atoms] C 100.0
/92.1 1
/1 NCAP_SARS2 Nucleoprotein

7n3c[1] W IOD
IODIDE ION[1 atoms] C 100.0
/92.1 4
/4 NCAP_SARS2 Nucleoprotein

7n3c[1] X IOD
IODIDE ION[1 atoms] C 100.0
/92.1 2
/2 NCAP_SARS2 Nucleoprotein

4ud1[3] F NH4
AMMONIUM ION[1 atoms] A 0.0
/58.3 2
/2 T2B9R0_9BETC N PROTEIN

4ud1[1] J NH4
AMMONIUM ION[1 atoms] C 100.0
/58.3 1
/1 T2B9R0_9BETC N PROTEIN

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2cjr[114] B NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa] A 100.0
/100.0 52
/52 NCAP_CVHSA NUCLEOCAPSID PROTEIN

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0 8
/8 NCAP_CVHSA Nucleocapsid protein

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/100.0 6
/6 NCAP_CVHSA Nucleocapsid protein

2gib[2] B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/100.0 1
/1 NCAP_CVHSA Nucleocapsid protein

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/100.0 3
/3 NCAP_CVHSA Nucleocapsid protein

7f2e[1] F NCAP_SARS2 Nucleoprotein[97 aa] E 97.7
/94.8 43
/43 NCAP_SARS2 Nucleoprotein

7f2e[1] L NCAP_SARS2 Nucleoprotein[92 aa] K 97.6
/94.8 41
/41 NCAP_SARS2 Nucleoprotein

6vyo[122] B NCAP_SARS2 Nucleoprotein[125 aa] A 91.7
/91.9 12
/12 NCAP_SARS2 Nucleoprotein

6vyo[12] D NCAP_SARS2 Nucleoprotein[125 aa] A 88.9
/91.9 9
/9 NCAP_SARS2 Nucleoprotein

7xx1[4] D NCAP_SARS2 Nucleoprotein[119 aa] A 87.5
/92.0 8
/8 NCAP_SARS2 Nucleoprotein

8iv3[2] B NCAP_SARS2 Nucleoprotein[128 aa] A 83.3
/92.1 6
/6 NCAP_SARS2 Nucleoprotein

8iv3[2] C NCAP_SARS2 Nucleoprotein[128 aa] A 90.0
/92.1 10
/10 NCAP_SARS2 Nucleoprotein

8iv3[2] D NCAP_SARS2 Nucleoprotein[126 aa] A 90.9
/92.1 11
/11 NCAP_SARS2 Nucleoprotein

8iv3[4] A NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/92.2 10
/10 NCAP_SARS2 Nucleoprotein

8iv3[2] C NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.2 6
/6 NCAP_SARS2 Nucleoprotein

8iv3[2] D NCAP_SARS2 Nucleoprotein[126 aa] B 100.0
/92.2 4
/4 NCAP_SARS2 Nucleoprotein

8iv3[4] A NCAP_SARS2 Nucleoprotein[126 aa] C 87.5
/92.2 8
/8 NCAP_SARS2 Nucleoprotein

8x1h[48] A NCAP_SARS2 Nucleoprotein[128 aa] A 92.2
/92.2 128
/128 NCAP_SARS2 Nucleoprotein

8x1h[16] A NCAP_SARS2 Nucleoprotein[128 aa] B 100.0
/92.3 13
/13 NCAP_SARS2 Nucleoprotein

8x1h[16] D NCAP_SARS2 Nucleoprotein[122 aa] C 100.0
/92.1 1
/1 NCAP_SARS2 Nucleoprotein

8x1h[16] C NCAP_SARS2 Nucleoprotein[127 aa] D 100.0
/91.8 1
/1 NCAP_SARS2 Nucleoprotein

6kl2[12] C A0A0D3MU65_9BETC Nucleoprotein[104 aa] A 71.4
/61.4 7
/9 A0A0D3MU65_9BETC Nucleoprotein

6lnn[16] C A0A2I2MQD0_9BETC Nucleoprotein[114 aa] A 77.8
/58.7 9
/12 A0A2I2MQD0_9BETC Nucleoprotein

6g13[4] C A0A0D3MU51_9BETC Nucleoprotein[113 aa] A 63.0
/54.3 54
/55 A0A0D3MU51_9BETC Nucleoprotein

5n4k[2] B NCAP_CVHNL Nucleoprotein[129 aa] A 33.3
/45.5 12
/22 NCAP_CVHNL Nucleoprotein

2gec[1] B NCAP_IBVG Nucleocapsid protein[139 aa] A 27.8
/41.3 18
/18 NCAP_IBVG Nucleocapsid protein

2gec[1] A NCAP_IBVG Nucleocapsid protein[138 aa] B 36.8
/41.3 19
/25 NCAP_IBVG Nucleocapsid protein

5epw[2] B NCAP_CVHNL Nucleoprotein[110 aa] A 32.6
/40.0 43
/54 NCAP_CVHNL Nucleoprotein

8ym1[8] F nucleocapsid phosphoprotein[103 aa] A 33.3
/35.2 51
/52 nucleocapsid phosphoprotein

2ca1[11] B Q4ZJS4_9CORO NUCLEOCAPSID PROTEIN[102 aa] A 33.3
/27.8 54
/54 Q4ZJS4_9CORO NUCLEOCAPSID PROTEIN

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

422 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7f2b[2] C PO4
PHOSPHATE ION[5 atoms] A 100.0
/95.3 1
/1 NCAP_SARS2 Nucleoprotein

7f2b[3] D PO4
PHOSPHATE ION[5 atoms] A 100.0
/95.3 2
/2 NCAP_SARS2 Nucleoprotein

7f2b[1] F PO4
PHOSPHATE ION[5 atoms] B 80.0
/95.3 5
/5 NCAP_SARS2 Nucleoprotein

7f2b[1] H PO4
PHOSPHATE ION[5 atoms] B 100.0
/95.3 3
/3 NCAP_SARS2 Nucleoprotein

7f2e[4] M PO4
PHOSPHATE ION[5 atoms] G 100.0
/95.3 3
/3 NCAP_SARS2 Nucleoprotein

7f2e[4] M PO4
PHOSPHATE ION[5 atoms] H 100.0
/95.3 1
/1 NCAP_SARS2 Nucleoprotein

7xwx[3] I PO4
PHOSPHATE ION[5 atoms] A 100.0
/96.0 2
/2 NCAP_SARS2 Nucleoprotein

2gib[5] C SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 NCAP_CVHSA Nucleocapsid protein

5n4k[4] D SO4
SULFATE ION[5 atoms] A 66.7
/45.5 3
/3 NCAP_CVHNL Nucleoprotein

5n4k[1] I SO4
SULFATE ION[5 atoms] A 50.0
/45.5 2
/2 NCAP_CVHNL Nucleoprotein

5n4k[7] J SO4
SULFATE ION[5 atoms] A 50.0
/45.5 2
/4 NCAP_CVHNL Nucleoprotein

5n4k[2] K SO4
SULFATE ION[5 atoms] A 0.0
/45.5 2
/2 NCAP_CVHNL Nucleoprotein

6wzq[1] F SO4
SULFATE ION[5 atoms] A 100.0
/95.6 1
/1 NCAP_SARS2 Nucleoprotein

6wzq[3] G SO4
SULFATE ION[5 atoms] B 100.0
/95.6 1
/1 NCAP_SARS2 Nucleoprotein

6wzq[1] I SO4
SULFATE ION[5 atoms] C 100.0
/95.7 3
/3 NCAP_SARS2 Nucleoprotein

7n0r[1] F SO4
SULFATE ION[5 atoms] B 100.0
/92.1 2
/2 NCAP_SARS2 Nucleoprotein

7n0r[1] G SO4
SULFATE ION[5 atoms] B 100.0
/92.1 4
/4 NCAP_SARS2 Nucleoprotein

6g13[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 80.0
/54.3 5
/5 A0A0D3MU51_9BETC Nucleoprotein

7c22[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7de1[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/95.7 5
/5 NCAP_SARS2 Nucleoprotein

7de1[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/95.7 2
/2 NCAP_SARS2 Nucleoprotein

7uxz[2] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/95.4 4
/4 NCAP_SARS2 Nucleoprotein

7uxz[1] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms] B 100.0
/95.4 1
/1 NCAP_SARS2 Nucleoprotein

7xxk[1] G SCN
THIOCYANATE ION[3 atoms] A 100.0
/95.4 5
/5 NCAP_SARS2 Nucleoprotein

6vyo[6] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/91.9 5
/5 NCAP_SARS2 Nucleoprotein

6vyo[6] G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/91.9 3
/3 NCAP_SARS2 Nucleoprotein

7xx1[4] G MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/92.0 4
/4 NCAP_SARS2 Nucleoprotein

7xx1[4] L MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/92.0 1
/1 NCAP_SARS2 Nucleoprotein

4ud1[2] I GOL
GLYCEROL[6 atoms] B 33.3
/58.3 3
/3 T2B9R0_9BETC N PROTEIN

4ud1[5] M GOL
GLYCEROL[6 atoms] D 0.0
/60.7 3
/3 T2B9R0_9BETC N PROTEIN

6vyo[3] K GOL
GLYCEROL[6 atoms] B 100.0
/92.0 3
/3 NCAP_SARS2 Nucleoprotein

6vyo[2] P GOL
GLYCEROL[6 atoms] C 83.3
/92.0 6
/6 NCAP_SARS2 Nucleoprotein

7o36[1] F GOL
GLYCEROL[6 atoms] B 100.0
/95.4 9
/9 NCAP_SARS2 Nucleoprotein

7uxx[1] G GOL
GLYCEROL[6 atoms] A 100.0
/95.4 4
/4 NCAP_SARS2 Nucleoprotein

7uxx[17] G GOL
GLYCEROL[6 atoms] C 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7uxx[3] J GOL
GLYCEROL[6 atoms] F 75.0
/95.5 4
/4 NCAP_SARS2 Nucleoprotein

7xwz[1] I GOL
GLYCEROL[6 atoms] B 66.7
/91.7 6
/6 NCAP_SARS2 Nucleoprotein

7c22[2] E ACT
ACETATE ION[4 atoms] A 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7c22[2] E ACT
ACETATE ION[4 atoms] B 100.0
/95.6 1
/1 NCAP_SARS2 Nucleoprotein

7n0i[1] M ACT
ACETATE ION[4 atoms] C 100.0
/95.8 3
/3 NCAP_SARS2 Nucleoprotein

7n0i[1] M ACT
ACETATE ION[4 atoms] D 100.0
/95.8 2
/2 NCAP_SARS2 Nucleoprotein

7n0i[1] O ACT
ACETATE ION[4 atoms] L 100.0
/95.8 2
/2 NCAP_SARS2 Nucleoprotein

7uxx[1] I ACT
ACETATE ION[4 atoms] B 100.0
/95.4 3
/3 NCAP_SARS2 Nucleoprotein

7uxx[1] I ACT
ACETATE ION[4 atoms] D 100.0
/95.4 2
/2 NCAP_SARS2 Nucleoprotein

7vnu[1] E ACT
ACETATE ION[4 atoms] C 100.0
/92.1 3
/3 NCAP_SARS2 Nucleoprotein

2ofz[1] B EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 NCAP_CVHSA Nucleocapsid protein

7n3c[1] M EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.1 1
/1 NCAP_SARS2 Nucleoprotein

7n3c[1] R EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.1 3
/3 NCAP_SARS2 Nucleoprotein

7n3c[1] S EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.1 5
/5 NCAP_SARS2 Nucleoprotein

7n3d[1] K EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.7 2
/2 NCAP_SARS2 Nucleoprotein

7n3d[2] L EDO
1,2-ETHANEDIOL[4 atoms] C 80.0
/92.7 5
/5 NCAP_SARS2 Nucleoprotein

7n3d[1] M EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.7 5
/5 NCAP_SARS2 Nucleoprotein

7n3d[1] N EDO
1,2-ETHANEDIOL[4 atoms] C 66.7
/92.7 3
/3 NCAP_SARS2 Nucleoprotein

7str[1] D EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/92.1 1
/1 NCAP_SARS2 Nucleoprotein

7str[1] G EDO
1,2-ETHANEDIOL[4 atoms] C 80.0
/92.1 5
/5 NCAP_SARS2 Nucleoprotein

7xwz[2] G EDO
1,2-ETHANEDIOL[4 atoms] A 66.7
/92.0 3
/3 NCAP_SARS2 Nucleoprotein

4ud1[2] H IMD
IMIDAZOLE[5 atoms] B 66.7
/58.3 3
/3 T2B9R0_9BETC N PROTEIN

6g13[1] E TMO
trimethylamine oxide[5 atoms] A 0.0
/54.3 1
/1 A0A0D3MU51_9BETC Nucleoprotein

6g13[3] F TMO
trimethylamine oxide[5 atoms] A 66.7
/54.3 3
/3 A0A0D3MU51_9BETC Nucleoprotein

4j3k[1] B TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] A 44.4
/49.2 9
/9 Q6SA23_CVHOC Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
422
	pdb_id	a¹	identity[%]²	description
	8fg2	B	91.2	NCAP_SARS2 Nucleoprotein
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7n0i[8]	H	Single-domain antibody E2[136 aa]	A	90.0 /95.8	10 /10	NCAP_SARS2 Nucleoprotein
	7ylb[8]	C	NC2[84 aa]	A	92.3 /95.4	13 /13	NCAP_SARS2 Nucleoprotein
	7yld[1]	H	NN2[71 aa]	C	91.7 /93.5	12 /12	NCAP_SARS2 Nucleoprotein
	7yld[3]	E	NN2[84 aa]	A	91.7 /92.9	12 /12	NCAP_SARS2 Nucleoprotein
	7r98[3]	D	Nanobody B6[129 aa]	A	100.0 /92.4	14 /14	NCAP_SARS2 Nucleoprotein
	7n3d[1]	A	S24-1564 Fab heavy chain[223 aa]	C	100.0 /92.7	12 /12	NCAP_SARS2 Nucleoprotein
	7n3d[1]	B	S24-1564 Fab light chain[213 aa]	C	87.5 /92.7	8 /8	NCAP_SARS2 Nucleoprotein
	7sue[2]	A	S24-188 Fab Light chain[212 aa]	E	100.0 /92.2	5 /5	NCAP_SARS2 Nucleoprotein
	7sue[2]	B	S24-188 Fab Heavy chain[227 aa]	E	100.0 /92.2	8 /8	NCAP_SARS2 Nucleoprotein
	7sue[2]	G	S24-188 Fab Light chain[109 aa]	K	100.0 /93.0	5 /5	NCAP_SARS2 Nucleoprotein
	7sue[2]	H	S24-188 Fab Heavy chain[129 aa]	K	100.0 /93.0	7 /7	NCAP_SARS2 Nucleoprotein
	7n3c[1]	A	S24-202 Fab heavy chain[226 aa]	C	100.0 /92.1	11 /11	NCAP_SARS2 Nucleoprotein
	7n0r[2]	C	Single-domain antibody C2[123 aa]	A	88.2 /92.1	17 /17	NCAP_SARS2 Nucleoprotein
	7n3c[2]	B	S24-202 Fab light chain[214 aa]	C	80.0 /92.1	5 /5	NCAP_SARS2 Nucleoprotein
	7str[1]	B	Fab S24-1063, Heavy chain[222 aa]	C	100.0 /92.1	11 /11	NCAP_SARS2 Nucleoprotein
	7cr5[1]	B	monoclonal antibody chain H[216 aa]	A	100.0 /92.0	7 /7	NCAP_SARS2 Nucleoprotein
	7cr5[1]	C	monoclonal antibody chain L[213 aa]	A	93.3 /92.0	15 /15	NCAP_SARS2 Nucleoprotein
	7pku[2]	A	A0A6M4N019_SARS2 3C-like proteinase[96 aa]	B	94.4 /89.0	18 /18	A0A6G9KDV1_SARS2 Nucleoprotein
	7wzo[1]	C	R1A_SARS2 nsp3[110 aa]	A	100.0 /92.0	10 /10	NCAP_SARS2 Nucleoprotein
	7sts[2]	E	Fab S24-1379, heavy chain[210 aa]	C	83.3 /92.8	6 /6	NCAP_SARS2 Nucleoprotein
	7sts[2]	F	Fab S24-1379, light chain[212 aa]	C	83.3 /92.8	6 /6	NCAP_SARS2 Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7act[1]	B	ssRNA	A	85.7 /92.7	28 /28	NCAP_SARS2 Nucleoprotein
	7acs[1]	B	RNA (5'-R(PCPAPCPUPGPAP*C)-3')	A	60.0 /92.0	5 /5	NCAP_SARS2 Nucleoprotein
	7xwz[1]	C	RNA (5'-R(CPAPCPUPGPAP*C)-3')	A	50.0 /92.0	2 /2	NCAP_SARS2 Nucleoprotein
	7acs[1]	C	RNA (5'-R(PGPUPCPAPGPUP*G)-3')	A	81.8 /92.0	11 /11	NCAP_SARS2 Nucleoprotein
	7xwz[2]	D	RNA (5'-R(PGPUPCPAPGPUP*G)-3')	A	100.0 /92.0	8 /8	NCAP_SARS2 Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7o35[3]	E	GTP GUANOSINE-5'-TRIPHOSPHATE[32 atoms]	C	100.0 /95.5	4 /4	NCAP_SARS2 Nucleoprotein
	7o35[3]	E	GTP GUANOSINE-5'-TRIPHOSPHATE[32 atoms]	D	100.0 /95.4	4 /4	NCAP_SARS2 Nucleoprotein
	4lm9[1]	B	5GP GUANOSINE-5'-MONOPHOSPHATE[24 atoms]	A	80.0 /48.8	10 /14	Q6SA23_CVHOC Nucleoprotein
	7xxk[3]	H	5GP GUANOSINE-5'-MONOPHOSPHATE[24 atoms]	A	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[3]	I	5GP GUANOSINE-5'-MONOPHOSPHATE[24 atoms]	A	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7uxz[1]	G	GKP (2R,3R)-2,3-bis{[(2E)-3-(3,4-dihydroxyphenyl)prop-..	A	100.0 /95.4	8 /8	NCAP_SARS2 Nucleoprotein
	7xxk[1]	R	GUN GUANINE[11 atoms]	C	100.0 /95.3	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	R	GUN GUANINE[11 atoms]	D	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[1]	FA	GMP GUANOSINE[20 atoms]	E	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	FA	GMP GUANOSINE[20 atoms]	F	100.0 /95.3	3 /3	NCAP_SARS2 Nucleoprotein
	8j6x[1]	E	U2H ~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y..	A	100.0 /92.1	2 /2	NCAP_SARS2 Nucleoprotein
	8j6x[1]	E	U2H ~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y..	B	100.0 /92.2	2 /2	NCAP_SARS2 Nucleoprotein
	8j6x[1]	E	U2H ~{N}-methyl-~{N}-[(5-phenylmethoxy-1~{H}-indol-3-y..	D	100.0 /92.1	4 /4	NCAP_SARS2 Nucleoprotein
	6kl6[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	B	83.3 /60.3	6 /6	A0A0D3MU65_9BETC Nucleoprotein
	6kl6[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	D	57.1 /62.2	7 /7	A0A0D3MU65_9BETC Nucleoprotein
	8iv3[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	A	66.7 /92.1	3 /3	NCAP_SARS2 Nucleoprotein
	8iv3[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	B	100.0 /92.2	1 /1	NCAP_SARS2 Nucleoprotein
	8iv3[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	D	100.0 /92.1	4 /4	NCAP_SARS2 Nucleoprotein
	6kl5[1]	E	DJO (phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..	A	75.0 /60.5	4 /4	A0A0D3MU65_9BETC Nucleoprotein
	6kl5[1]	E	DJO (phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..	C	50.0 /62.1	4 /4	A0A0D3MU65_9BETC Nucleoprotein
	7dyd[1]	E	EY3 5-propan-2-yloxy-1H-indole[13 atoms]	B	100.0 /59.1	1 /1	A0A2I2MQD0_9BETC Nucleoprotein
	7dyd[1]	E	EY3 5-propan-2-yloxy-1H-indole[13 atoms]	D	83.3 /61.8	6 /6	A0A2I2MQD0_9BETC Nucleoprotein
	6lz8[1]	E	EY9 5-(2-methoxyethoxy)-1H-indole[14 atoms]	C	100.0 /59.1	2 /2	A0A2I2MQD0_9BETC Nucleoprotein
	6lz8[1]	E	EY9 5-(2-methoxyethoxy)-1H-indole[14 atoms]	D	100.0 /61.6	3 /3	A0A2I2MQD0_9BETC Nucleoprotein
	6lnn[1]	E	EJC 5-propoxy-1H-indole[13 atoms]	B	100.0 /60.0	1 /1	A0A2I2MQD0_9BETC Nucleoprotein
	6lnn[1]	E	EJC 5-propoxy-1H-indole[13 atoms]	D	100.0 /61.3	5 /5	A0A2I2MQD0_9BETC Nucleoprotein
	6lz6[1]	E	EY6 5-(2-fluoranylethoxy)-1H-indole[13 atoms]	B	100.0 /59.1	1 /1	A0A2I2MQD0_9BETC Nucleoprotein
	6lz6[1]	E	EY6 5-(2-fluoranylethoxy)-1H-indole[13 atoms]	D	100.0 /60.9	7 /7	A0A2I2MQD0_9BETC Nucleoprotein
	4li4[1]	B	AMP ADENOSINE MONOPHOSPHATE[23 atoms]	A	80.0 /49.2	10 /14	Q6SA23_CVHOC Nucleoprotein
	4lm7[1]	B	U5P URIDINE-5'-MONOPHOSPHATE[21 atoms]	A	80.0 /49.2	10 /14	Q6SA23_CVHOC Nucleoprotein
	4lmt[1]	B	CQD 6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli..	A	83.3 /48.8	6 /10	Q6SA23_CVHOC Nucleoprotein
	4lmc[1]	B	C5P CYTIDINE-5'-MONOPHOSPHATE[21 atoms]	A	88.9 /48.8	9 /13	Q6SA23_CVHOC Nucleoprotein
	4kxj[1]	B	P34 N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH..	A	50.0 /48.4	6 /10	Q6SA23_CVHOC Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7n0i[1]	N	MG MAGNESIUM ION[1 atoms]	D	100.0 /95.8	3 /3	NCAP_SARS2 Nucleoprotein
	6g13[2]	I	CL CHLORIDE ION[1 atoms]	B	50.0 /54.2	2 /2	A0A0D3MU51_9BETC Nucleoprotein
	6vyo[13]	F	CL CHLORIDE ION[1 atoms]	A	100.0 /91.9	1 /1	NCAP_SARS2 Nucleoprotein
	6vyo[4]	I	CL CHLORIDE ION[1 atoms]	A	66.7 /91.9	3 /3	NCAP_SARS2 Nucleoprotein
	6wji[6]	G	CL CHLORIDE ION[1 atoms]	A	100.0 /95.4	1 /1	NCAP_SARS2 Nucleoprotein
	6wji[4]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /95.4	1 /1	NCAP_SARS2 Nucleoprotein
	7n3d[1]	O	CL CHLORIDE ION[1 atoms]	C	100.0 /92.7	2 /2	NCAP_SARS2 Nucleoprotein
	7n3d[1]	P	CL CHLORIDE ION[1 atoms]	C	100.0 /92.7	2 /2	NCAP_SARS2 Nucleoprotein
	7uxz[1]	L	CL CHLORIDE ION[1 atoms]	E	100.0 /95.4	1 /1	NCAP_SARS2 Nucleoprotein
	7xxk[1]	O	CL CHLORIDE ION[1 atoms]	B	100.0 /95.3	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	P	CL CHLORIDE ION[1 atoms]	B	100.0 /95.3	1 /1	NCAP_SARS2 Nucleoprotein
	7xxk[1]	V	CL CHLORIDE ION[1 atoms]	C	100.0 /95.3	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[1]	X	CL CHLORIDE ION[1 atoms]	C	100.0 /95.3	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[2]	Y	CL CHLORIDE ION[1 atoms]	C	100.0 /95.3	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[1]	EA	CL CHLORIDE ION[1 atoms]	E	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	IA	CL CHLORIDE ION[1 atoms]	F	100.0 /95.3	1 /1	NCAP_SARS2 Nucleoprotein
	7uxz[3]	J	NA SODIUM ION[1 atoms]	A	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[5]	J	K POTASSIUM ION[1 atoms]	A	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[2]	K	K POTASSIUM ION[1 atoms]	A	66.7 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	L	K POTASSIUM ION[1 atoms]	A	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7xxk[1]	M	K POTASSIUM ION[1 atoms]	A	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7xxk[5]	N	K POTASSIUM ION[1 atoms]	A	100.0 /95.4	1 /1	NCAP_SARS2 Nucleoprotein
	6vyo[12]	H	ZN ZINC ION[1 atoms]	A	66.7 /91.9	3 /3	NCAP_SARS2 Nucleoprotein
	6vyo[8]	J	ZN ZINC ION[1 atoms]	A	100.0 /91.9	1 /1	NCAP_SARS2 Nucleoprotein
	7cr5[1]	D	ZN ZINC ION[1 atoms]	A	100.0 /92.0	1 /1	NCAP_SARS2 Nucleoprotein
	7xx1[4]	J	ZN ZINC ION[1 atoms]	A	100.0 /92.0	1 /1	NCAP_SARS2 Nucleoprotein
	7n3c[1]	T	IOD IODIDE ION[1 atoms]	C	66.7 /92.1	3 /3	NCAP_SARS2 Nucleoprotein
	7n3c[1]	U	IOD IODIDE ION[1 atoms]	C	100.0 /92.1	2 /2	NCAP_SARS2 Nucleoprotein
	7n3c[1]	V	IOD IODIDE ION[1 atoms]	C	100.0 /92.1	1 /1	NCAP_SARS2 Nucleoprotein
	7n3c[1]	W	IOD IODIDE ION[1 atoms]	C	100.0 /92.1	4 /4	NCAP_SARS2 Nucleoprotein
	7n3c[1]	X	IOD IODIDE ION[1 atoms]	C	100.0 /92.1	2 /2	NCAP_SARS2 Nucleoprotein
	4ud1[3]	F	NH4 AMMONIUM ION[1 atoms]	A	0.0 /58.3	2 /2	T2B9R0_9BETC N PROTEIN
	4ud1[1]	J	NH4 AMMONIUM ION[1 atoms]	C	100.0 /58.3	1 /1	T2B9R0_9BETC N PROTEIN
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2cjr[114]	B	NCAP_CVHSA NUCLEOCAPSID PROTEIN[113 aa]	A	100.0 /100.0	52 /52	NCAP_CVHSA NUCLEOCAPSID PROTEIN
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	A	100.0 /100.0	8 /8	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	A	100.0 /100.0	6 /6	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	B	NCAP_CVHSA Nucleocapsid protein[96 aa]	A	100.0 /100.0	1 /1	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	B	100.0 /100.0	3 /3	NCAP_CVHSA Nucleocapsid protein
	7f2e[1]	F	NCAP_SARS2 Nucleoprotein[97 aa]	E	97.7 /94.8	43 /43	NCAP_SARS2 Nucleoprotein
	7f2e[1]	L	NCAP_SARS2 Nucleoprotein[92 aa]	K	97.6 /94.8	41 /41	NCAP_SARS2 Nucleoprotein
	6vyo[122]	B	NCAP_SARS2 Nucleoprotein[125 aa]	A	91.7 /91.9	12 /12	NCAP_SARS2 Nucleoprotein
	6vyo[12]	D	NCAP_SARS2 Nucleoprotein[125 aa]	A	88.9 /91.9	9 /9	NCAP_SARS2 Nucleoprotein
	7xx1[4]	D	NCAP_SARS2 Nucleoprotein[119 aa]	A	87.5 /92.0	8 /8	NCAP_SARS2 Nucleoprotein
	8iv3[2]	B	NCAP_SARS2 Nucleoprotein[128 aa]	A	83.3 /92.1	6 /6	NCAP_SARS2 Nucleoprotein
	8iv3[2]	C	NCAP_SARS2 Nucleoprotein[128 aa]	A	90.0 /92.1	10 /10	NCAP_SARS2 Nucleoprotein
	8iv3[2]	D	NCAP_SARS2 Nucleoprotein[126 aa]	A	90.9 /92.1	11 /11	NCAP_SARS2 Nucleoprotein
	8iv3[4]	A	NCAP_SARS2 Nucleoprotein[126 aa]	B	100.0 /92.2	10 /10	NCAP_SARS2 Nucleoprotein
	8iv3[2]	C	NCAP_SARS2 Nucleoprotein[128 aa]	B	100.0 /92.2	6 /6	NCAP_SARS2 Nucleoprotein
	8iv3[2]	D	NCAP_SARS2 Nucleoprotein[126 aa]	B	100.0 /92.2	4 /4	NCAP_SARS2 Nucleoprotein
	8iv3[4]	A	NCAP_SARS2 Nucleoprotein[126 aa]	C	87.5 /92.2	8 /8	NCAP_SARS2 Nucleoprotein
	8x1h[48]	A	NCAP_SARS2 Nucleoprotein[128 aa]	A	92.2 /92.2	128 /128	NCAP_SARS2 Nucleoprotein
	8x1h[16]	A	NCAP_SARS2 Nucleoprotein[128 aa]	B	100.0 /92.3	13 /13	NCAP_SARS2 Nucleoprotein
	8x1h[16]	D	NCAP_SARS2 Nucleoprotein[122 aa]	C	100.0 /92.1	1 /1	NCAP_SARS2 Nucleoprotein
	8x1h[16]	C	NCAP_SARS2 Nucleoprotein[127 aa]	D	100.0 /91.8	1 /1	NCAP_SARS2 Nucleoprotein
	6kl2[12]	C	A0A0D3MU65_9BETC Nucleoprotein[104 aa]	A	71.4 /61.4	7 /9	A0A0D3MU65_9BETC Nucleoprotein
	6lnn[16]	C	A0A2I2MQD0_9BETC Nucleoprotein[114 aa]	A	77.8 /58.7	9 /12	A0A2I2MQD0_9BETC Nucleoprotein
	6g13[4]	C	A0A0D3MU51_9BETC Nucleoprotein[113 aa]	A	63.0 /54.3	54 /55	A0A0D3MU51_9BETC Nucleoprotein
	5n4k[2]	B	NCAP_CVHNL Nucleoprotein[129 aa]	A	33.3 /45.5	12 /22	NCAP_CVHNL Nucleoprotein
	2gec[1]	B	NCAP_IBVG Nucleocapsid protein[139 aa]	A	27.8 /41.3	18 /18	NCAP_IBVG Nucleocapsid protein
	2gec[1]	A	NCAP_IBVG Nucleocapsid protein[138 aa]	B	36.8 /41.3	19 /25	NCAP_IBVG Nucleocapsid protein
	5epw[2]	B	NCAP_CVHNL Nucleoprotein[110 aa]	A	32.6 /40.0	43 /54	NCAP_CVHNL Nucleoprotein
	8ym1[8]	F	nucleocapsid phosphoprotein[103 aa]	A	33.3 /35.2	51 /52	nucleocapsid phosphoprotein
	2ca1[11]	B	Q4ZJS4_9CORO NUCLEOCAPSID PROTEIN[102 aa]	A	33.3 /27.8	54 /54	Q4ZJS4_9CORO NUCLEOCAPSID PROTEIN
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
422	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7f2b[2]	C	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /95.3	1 /1	NCAP_SARS2 Nucleoprotein
	7f2b[3]	D	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /95.3	2 /2	NCAP_SARS2 Nucleoprotein
	7f2b[1]	F	PO4 PHOSPHATE ION[5 atoms]	B	80.0 /95.3	5 /5	NCAP_SARS2 Nucleoprotein
	7f2b[1]	H	PO4 PHOSPHATE ION[5 atoms]	B	100.0 /95.3	3 /3	NCAP_SARS2 Nucleoprotein
	7f2e[4]	M	PO4 PHOSPHATE ION[5 atoms]	G	100.0 /95.3	3 /3	NCAP_SARS2 Nucleoprotein
	7f2e[4]	M	PO4 PHOSPHATE ION[5 atoms]	H	100.0 /95.3	1 /1	NCAP_SARS2 Nucleoprotein
	7xwx[3]	I	PO4 PHOSPHATE ION[5 atoms]	A	100.0 /96.0	2 /2	NCAP_SARS2 Nucleoprotein
	2gib[5]	C	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	2 /2	NCAP_CVHSA Nucleocapsid protein
	5n4k[4]	D	SO4 SULFATE ION[5 atoms]	A	66.7 /45.5	3 /3	NCAP_CVHNL Nucleoprotein
	5n4k[1]	I	SO4 SULFATE ION[5 atoms]	A	50.0 /45.5	2 /2	NCAP_CVHNL Nucleoprotein
	5n4k[7]	J	SO4 SULFATE ION[5 atoms]	A	50.0 /45.5	2 /4	NCAP_CVHNL Nucleoprotein
	5n4k[2]	K	SO4 SULFATE ION[5 atoms]	A	0.0 /45.5	2 /2	NCAP_CVHNL Nucleoprotein
	6wzq[1]	F	SO4 SULFATE ION[5 atoms]	A	100.0 /95.6	1 /1	NCAP_SARS2 Nucleoprotein
	6wzq[3]	G	SO4 SULFATE ION[5 atoms]	B	100.0 /95.6	1 /1	NCAP_SARS2 Nucleoprotein
	6wzq[1]	I	SO4 SULFATE ION[5 atoms]	C	100.0 /95.7	3 /3	NCAP_SARS2 Nucleoprotein
	7n0r[1]	F	SO4 SULFATE ION[5 atoms]	B	100.0 /92.1	2 /2	NCAP_SARS2 Nucleoprotein
	7n0r[1]	G	SO4 SULFATE ION[5 atoms]	B	100.0 /92.1	4 /4	NCAP_SARS2 Nucleoprotein
	6g13[1]	G	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	80.0 /54.3	5 /5	A0A0D3MU51_9BETC Nucleoprotein
	7c22[1]	F	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7de1[1]	C	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /95.7	5 /5	NCAP_SARS2 Nucleoprotein
	7de1[2]	D	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /95.7	2 /2	NCAP_SARS2 Nucleoprotein
	7uxz[2]	H	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /95.4	4 /4	NCAP_SARS2 Nucleoprotein
	7uxz[1]	H	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	B	100.0 /95.4	1 /1	NCAP_SARS2 Nucleoprotein
	7xxk[1]	G	SCN THIOCYANATE ION[3 atoms]	A	100.0 /95.4	5 /5	NCAP_SARS2 Nucleoprotein
	6vyo[6]	E	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	A	100.0 /91.9	5 /5	NCAP_SARS2 Nucleoprotein
	6vyo[6]	G	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	A	100.0 /91.9	3 /3	NCAP_SARS2 Nucleoprotein
	7xx1[4]	G	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	A	100.0 /92.0	4 /4	NCAP_SARS2 Nucleoprotein
	7xx1[4]	L	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	A	100.0 /92.0	1 /1	NCAP_SARS2 Nucleoprotein
	4ud1[2]	I	GOL GLYCEROL[6 atoms]	B	33.3 /58.3	3 /3	T2B9R0_9BETC N PROTEIN
	4ud1[5]	M	GOL GLYCEROL[6 atoms]	D	0.0 /60.7	3 /3	T2B9R0_9BETC N PROTEIN
	6vyo[3]	K	GOL GLYCEROL[6 atoms]	B	100.0 /92.0	3 /3	NCAP_SARS2 Nucleoprotein
	6vyo[2]	P	GOL GLYCEROL[6 atoms]	C	83.3 /92.0	6 /6	NCAP_SARS2 Nucleoprotein
	7o36[1]	F	GOL GLYCEROL[6 atoms]	B	100.0 /95.4	9 /9	NCAP_SARS2 Nucleoprotein
	7uxx[1]	G	GOL GLYCEROL[6 atoms]	A	100.0 /95.4	4 /4	NCAP_SARS2 Nucleoprotein
	7uxx[17]	G	GOL GLYCEROL[6 atoms]	C	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7uxx[3]	J	GOL GLYCEROL[6 atoms]	F	75.0 /95.5	4 /4	NCAP_SARS2 Nucleoprotein
	7xwz[1]	I	GOL GLYCEROL[6 atoms]	B	66.7 /91.7	6 /6	NCAP_SARS2 Nucleoprotein
	7c22[2]	E	ACT ACETATE ION[4 atoms]	A	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7c22[2]	E	ACT ACETATE ION[4 atoms]	B	100.0 /95.6	1 /1	NCAP_SARS2 Nucleoprotein
	7n0i[1]	M	ACT ACETATE ION[4 atoms]	C	100.0 /95.8	3 /3	NCAP_SARS2 Nucleoprotein
	7n0i[1]	M	ACT ACETATE ION[4 atoms]	D	100.0 /95.8	2 /2	NCAP_SARS2 Nucleoprotein
	7n0i[1]	O	ACT ACETATE ION[4 atoms]	L	100.0 /95.8	2 /2	NCAP_SARS2 Nucleoprotein
	7uxx[1]	I	ACT ACETATE ION[4 atoms]	B	100.0 /95.4	3 /3	NCAP_SARS2 Nucleoprotein
	7uxx[1]	I	ACT ACETATE ION[4 atoms]	D	100.0 /95.4	2 /2	NCAP_SARS2 Nucleoprotein
	7vnu[1]	E	ACT ACETATE ION[4 atoms]	C	100.0 /92.1	3 /3	NCAP_SARS2 Nucleoprotein
	2ofz[1]	B	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /100.0	2 /2	NCAP_CVHSA Nucleocapsid protein
	7n3c[1]	M	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.1	1 /1	NCAP_SARS2 Nucleoprotein
	7n3c[1]	R	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.1	3 /3	NCAP_SARS2 Nucleoprotein
	7n3c[1]	S	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.1	5 /5	NCAP_SARS2 Nucleoprotein
	7n3d[1]	K	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.7	2 /2	NCAP_SARS2 Nucleoprotein
	7n3d[2]	L	EDO 1,2-ETHANEDIOL[4 atoms]	C	80.0 /92.7	5 /5	NCAP_SARS2 Nucleoprotein
	7n3d[1]	M	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.7	5 /5	NCAP_SARS2 Nucleoprotein
	7n3d[1]	N	EDO 1,2-ETHANEDIOL[4 atoms]	C	66.7 /92.7	3 /3	NCAP_SARS2 Nucleoprotein
	7str[1]	D	EDO 1,2-ETHANEDIOL[4 atoms]	C	100.0 /92.1	1 /1	NCAP_SARS2 Nucleoprotein
	7str[1]	G	EDO 1,2-ETHANEDIOL[4 atoms]	C	80.0 /92.1	5 /5	NCAP_SARS2 Nucleoprotein
	7xwz[2]	G	EDO 1,2-ETHANEDIOL[4 atoms]	A	66.7 /92.0	3 /3	NCAP_SARS2 Nucleoprotein
	4ud1[2]	H	IMD IMIDAZOLE[5 atoms]	B	66.7 /58.3	3 /3	T2B9R0_9BETC N PROTEIN
	6g13[1]	E	TMO trimethylamine oxide[5 atoms]	A	0.0 /54.3	1 /1	A0A0D3MU51_9BETC Nucleoprotein
	6g13[3]	F	TMO trimethylamine oxide[5 atoms]	A	66.7 /54.3	3 /3	A0A0D3MU51_9BETC Nucleoprotein
	4j3k[1]	B	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]	A	44.4 /49.2	9 /9	Q6SA23_CVHOC Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P59595(NCAP_SARS)]