#WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/3768.bltA' #WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/3768.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3768 422 0 P59595(NCAP_SARS) RecName: Full=Nucleoprotein ;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;
QUERYSEQ
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTR
NPNNNAATVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59595(NCAP_SARS)]

422
region name description
1-422 CHAIN /note="Nucleoprotein" /id="PRO_0000106003"
49-176 DOMAIN /note="CoV N NTD"
248-365 DOMAIN /note="CoV N CTD"
42-187 REGION /note="RNA-binding"
45-181 REGION /note="RNA-binding"
259-362 REGION /note="Dimerization"
181-213 COMPBIAS /note="Ser-rich"
220-225 COMPBIAS /note="Poly-Leu"
240-245 COMPBIAS /note="Poly-Gln"
370-376 COMPBIAS /note="Poly-Lys"

No homologue is found in PDB.

Please check [SiteTable] for homologues.