#WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/25218.bltA' #WARNING:Can't open blastfile '/filesv4_homcos_data/TMPOUTSCH/25218.psiA'

[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
25218 1255 0 P59594(SPIKE_SARS) RecName: Full=Spike glycoprotein ; Short=S glycoprotein ;AltName: Full=E2 ;AltName: Full=Peplomer protein ;Contains: RecName: Full=Spike protein S1 ;Contains: RecName: Full=Spike protein S2 ;Contains: RecName: Full=Spike protein S2' ;Flags: Precursor;
QUERYSEQ
MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPDEIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWVFGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHT
MIFDNAFNCTFEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKPIFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAVDCSQNPLAELKCSVKSFEIDKGIY
QTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP
FERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPKTSEILDISPCSFGGVSVITPGTNASSEVAVLYQD
VNCTDVSTAIHADQLTPAWRIYSTGNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLGADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGSFCTQLNRALS
GIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRSFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYE
NQKQIANQFNKAISQIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYV
PSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQRNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWL
GFIAGLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P59594(SPIKE_SARS)]

1255
region name description
1-13 SIGNAL
14-1255 CHAIN /note="Spike glycoprotein" /id="PRO_0000037208"
14-667 CHAIN /note="Spike protein S1" /id="PRO_0000037209"
668-1255 CHAIN /note="Spike protein S2" /id="PRO_0000037210"
798-1255 CHAIN /note="Spike protein S2'" /id="PRO_0000444082"
14-1195 TOPO_DOM /note="Extracellular"
1196-1216 TRANSMEM /note="Helical"
1217-1255 TOPO_DOM /note="Cytoplasmic"
14-290 DOMAIN /note="BetaCoV S1-NTD"
321-513 DOMAIN /note="BetaCoV S1-CTD"
306-527 REGION /note="Receptor-binding domain"
424-494 REGION /note="Receptor-binding motif; binding to human ACE2"
798-819 REGION /note="Fusion peptide 1" ECO:0000305|PubMed:29056462"
817-837 REGION /note="Fusion peptide 2" ECO:0000305|PubMed:29056462"
902-952 REGION /note="Heptad repeat 1"
1145-1184 REGION /note="Heptad repeat 2"
931-975 COILED
1157-1185 COILED
1217-1236 COMPBIAS /note="Cys-rich"

No homologue is found in PDB.

Please check [SiteTable] for homologues.