Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2711687 385 54 P35613(BASI_HUMAN) RecName: Full=Basigin ;AltName: Full=5F7;AltName: Full=Collagenase stimulatory factor;AltName: Full=Extracellular matrix metalloproteinase inducer; Short=EMMPRIN;AltName: Full=Hepatoma-associated antigen ; Short=HAb18G ;AltName: Full=Leukocyte activation antigen M6;AltName: Full=OK blood group antigen;AltName: Full=Tumor cell-derived collagenase stimulatory factor; Short=TCSF;AltName: CD_antigen=CD147;Flags: Precursor;
QUERYSEQ 
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG
SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P35613(BASI_HUMAN)]

385
region name description
1-21 SIGNAL
22-385 CHAIN /note="Basigin" /id="PRO_0000014518"
138-323 TOPO_DOM /note="Extracellular"
324-344 TRANSMEM /note="Helical"
345-385 TOPO_DOM /note="Cytoplasmic"
37-120 DOMAIN /note="Ig-like"
138-219 DOMAIN /note="Ig-like C2-type"
221-315 DOMAIN /note="Ig-like V-type"
353-385 REGION /note="Disordered"
356132195-199 REGION /note="Essential for interaction with KDR/VEGFR2"
1-385 DISORDER predicted by DISOPRED

MONOMER
385
pdb_id a1 identity[%]2 description
6lz0 B 100.0 BASI_HUMAN Basigin
3qr2 A 99.1 BASI_HUMAN Basigin 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4u0q[1] A B2L3N7_PLAFA Reticulocyte binding protein 5[286 aa] B 100.0
/100.0		 24
/25		 BASI_HUMAN Basigin
4u0q[1] C B2L3N7_PLAFA Reticulocyte binding protein 5[285 aa] D 100.0
/100.0		 20
/21		 BASI_HUMAN Basigin
5x0t[2] A 6H8 Fab fragment heavy chain[215 aa] E 100.0
/100.0		 9
/9		 BASI_HUMAN Basigin
5x0t[2] C 6H8 Fab fragment light chain[213 aa] E 100.0
/100.0		 7
/7		 BASI_HUMAN Basigin
7daa[3] B Light chain of antibody Fab fragment[217 aa] A 100.0
/98.8		 14
/14		 BASI_HUMAN Isoform 2 of Basigin
7daa[3] C Heavy chain of antibody Fab fragment[212 aa] A 100.0
/98.8		 7
/7		 BASI_HUMAN Isoform 2 of Basigin
7dce[2] B XKR8_HUMAN XK-related protein 8[355 aa] A 100.0
/98.5		 12
/12		 BASI_HUMAN Isoform 2 of Basigin
7y1b[1] B Heavy chain of 6E7F1[214 aa] A 40.0
/50.0		 10
/11		 BASI_MOUSE Isoform 2 of Basigin
7y1b[1] C Light chain of 6E7F1[213 aa] A 22.2
/50.0		 9
/10		 BASI_MOUSE Isoform 2 of Basigin
6a69[1] A AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1[911 .. B 75.0
/47.2		 16
/16		 NPTN_HUMAN Neuroplastin
6lyy[5] A MOT1_HUMAN Monocarboxylate transporter 1[382 aa] B 100.0
/100.0		 10
/10		 BASI_HUMAN Basigin
7yr5[1] B MOT1_HUMAN Monocarboxylate transporter 1[385 aa] A 56.2
/38.6		 16
/16		 EMB_HUMAN Embigin
7o52[1] A m971 Fab Heavy chain[227 aa] C 20.0
/30.3		 15
/15		 CD22 d6-d7 Ig domains
7o52[1] B m971 Fab Light chain[215 aa] C 33.3
/30.3		 6
/6		 CD22 d6-d7 Ig domains
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2wv3[1] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 0.0
/35.8		 3
/6		 NPTN_RAT NEUROPLASTIN
2wv3[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 60.0
/35.8		 5
/5		 NPTN_RAT NEUROPLASTIN
5k6z[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 0.0
/29.6		 2
/2		 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
5k6z[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 0.0
/29.6		 1
/1		 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
6a69[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		B 75.0
/47.2		 4
/4		 NPTN_HUMAN Neuroplastin
6dld[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 0.0
/30.6		 2
/2		 IGLO5_HUMAN IgLON family member 5
6dle[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		B 100.0
/30.6		 1
/1		 IGLO5_HUMAN IgLON family member 5
6zr7[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 50.0
/40.5		 2
/2		 DSCAM_HUMAN Down syndrome cell adhesion molecule
7o52[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		C 0.0
/30.3		 2
/2		 CD22 d6-d7 Ig domains
8a0y[2] O NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 50.0
/32.1		 2
/2		 CNTN2_MOUSE Contactin-2
8a0y[3] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/32.1		 1
/1		 CNTN2_MOUSE Contactin-2
8k53[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. 		A 100.0
/32.5		 1
/1		 CNTN2_HUMAN Contactin-2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7daa[1] D CD
CADMIUM ION[1 atoms] 		A 100.0
/98.8		 1
/1		 BASI_HUMAN Isoform 2 of Basigin
7daa[1] E CD
CADMIUM ION[1 atoms] 		A 100.0
/98.8		 1
/1		 BASI_HUMAN Isoform 2 of Basigin
7daa[1] F CD
CADMIUM ION[1 atoms] 		A 100.0
/98.8		 1
/1		 BASI_HUMAN Isoform 2 of Basigin
3i84[4] C CL
CHLORIDE ION[1 atoms] 		B 100.0
/98.7		 1
/1		 Q54A51_HUMAN Cervical EMMPRIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zr7[1] B N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galact.. A 0.0
/40.5		 1
/8		 DSCAM_HUMAN Down syndrome cell adhesion molecule
6zr7[1] C beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-b.. A 0.0
/40.5		 6
/6		 DSCAM_HUMAN Down syndrome cell adhesion molecule
7ok5[1] D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/36.1		 1
/7		 Neurofascin 155
7ol4[1] P alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 0.0
/35.6		 6
/6		 Neurofascin
7ol4[1] T alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. D 0.0
/35.6		 5
/6		 Neurofascin
7ok5[3] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/36.1		 5
/7		 Neurofascin 155
8a0y[1] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 0.0
/32.1		 3
/3		 CNTN2_MOUSE Contactin-2
7ok5[2] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/36.1		 2
/9		 Neurofascin 155
8a0y[1] J alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/32.1		 2
/2		 CNTN2_MOUSE Contactin-2
8a0y[1] F alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/32.1		 1
/1		 CNTN2_MOUSE Contactin-2
8a0y[1] M alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 0.0
/32.1		 2
/2		 CNTN2_MOUSE Contactin-2
5k6z[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/29.6		 2
/2		 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
8k53[2] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/32.5		 1
/1		 CNTN2_HUMAN Contactin-2
8k53[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 33.3
/32.0		 3
/3		 CNTN2_HUMAN Contactin-2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3qqn[6] B BASI_HUMAN Basigin[116 aa] A 100.0
/98.3		 14
/15		 BASI_HUMAN Basigin
3qr2[2] A BASI_HUMAN Basigin[117 aa] A 100.0
/99.1		 1
/1		 BASI_HUMAN Basigin
3qr2[4] B BASI_HUMAN Basigin[116 aa] A 100.0
/99.1		 7
/7		 BASI_HUMAN Basigin
3qr2[2] B BASI_HUMAN Basigin[116 aa] B 100.0
/99.1		 7
/7		 BASI_HUMAN Basigin
3i84[6] A Q54A51_HUMAN Cervical EMMPRIN[79 aa] A 100.0
/98.7		 7
/7		 Q54A51_HUMAN Cervical EMMPRIN
3i84[4] B Q54A51_HUMAN Cervical EMMPRIN[85 aa] A 100.0
/98.7		 36
/36		 Q54A51_HUMAN Cervical EMMPRIN
8k53[1] B CNTN2_HUMAN Contactin-2[573 aa] A 33.3
/32.5		 6
/12		 CNTN2_HUMAN Contactin-2
1nbq[2] B JAM1_HUMAN Junctional adhesion molecule 1[208 aa] A 0.0
/32.2		 7
/11		 JAM1_HUMAN Junctional adhesion molecule 1
8a0y[2] C CNTN2_MOUSE Contactin-2[574 aa] A 21.4
/32.1		 14
/20		 CNTN2_MOUSE Contactin-2
8k53[1] A CNTN2_HUMAN Contactin-2[777 aa] B 30.0
/32.0		 10
/13		 CNTN2_HUMAN Contactin-2
5k6z[2] B SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera[378 .. A 16.7
/29.6		 6
/27		 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3b5h[1] E ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 Q54A51_HUMAN Cervical EMMPRIN
7o52[1] D SO4
SULFATE ION[5 atoms] 		C 0.0
/30.3		 1
/1		 CD22 d6-d7 Ig domains
7o52[1] J SO4
SULFATE ION[5 atoms] 		C 50.0
/30.3		 2
/2		 CD22 d6-d7 Ig domains
7o52[1] K SO4
SULFATE ION[5 atoms] 		C 0.0
/30.3		 3
/3		 CD22 d6-d7 Ig domains
7o52[1] L GOL
GLYCEROL[6 atoms] 		C 0.0
/30.3		 3
/3		 CD22 d6-d7 Ig domains
5k6z[2] H MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 0.0
/29.6		 2
/5		 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.