HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
1680312	385	48	P35613(BASI_HUMAN)	RecName: Full=Basigin ;AltName: Full=5F7;AltName: Full=Collagenase stimulatory factor;AltName: Full=Extracellular matrix metalloproteinase inducer; Short=EMMPRIN;AltName: Full=Hepatoma-associated antigen ; Short=HAb18G ;AltName: Full=Leukocyte activation antigen M6;AltName: Full=OK blood group antigen;AltName: Full=Tumor cell-derived collagenase stimulatory factor; Short=TCSF;AltName: CD_antigen=CD147;Flags: Precursor;
QUERYSEQ	MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P35613(BASI_HUMAN)]

385
	region	name	description
	1-21	SIGNAL
	22-385	CHAIN	/note="Basigin" /id="PRO_0000014518"
	138-323	TOPO_DOM	/note="Extracellular"
	324-344	TRANSMEM	/note="Helical"
	345-385	TOPO_DOM	/note="Cytoplasmic"
	37-120	DOMAIN	/note="Ig-like"
	138-219	DOMAIN	/note="Ig-like C2-type"
	221-315	DOMAIN	/note="Ig-like V-type"
	353-385	REGION	/note="Disordered"
	356132195-199	REGION	/note="Essential for interaction with KDR/VEGFR2"
	1-385	DISORDER	predicted by DISOPRED

MONOMER

385

pdb_id a¹ identity[%]² description

7cko B 100.0 BASI_HUMAN Basigin

3qr2 A 99.1 BASI_HUMAN Basigin

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4u0q[1] A B2L3N7_PLAFA Reticulocyte binding protein 5[286 aa] B 100.0
/100.0 24
/25 BASI_HUMAN Basigin

4u0q[1] C B2L3N7_PLAFA Reticulocyte binding protein 5[285 aa] D 100.0
/100.0 20
/21 BASI_HUMAN Basigin

5x0t[2] A 6H8 Fab fragment heavy chain[215 aa] E 100.0
/100.0 9
/9 BASI_HUMAN Basigin

5x0t[2] C 6H8 Fab fragment light chain[213 aa] E 100.0
/100.0 7
/7 BASI_HUMAN Basigin

7xy8[2] C heavy chain[212 aa] A 100.0
/100.0 15
/15 BASI_HUMAN Isoform 2 of Basigin

7xy8[2] E light chain[214 aa] A 100.0
/100.0 8
/8 BASI_HUMAN Isoform 2 of Basigin

7daa[2] B Light chain of antibody Fab fragment[217 aa] A 100.0
/98.8 14
/14 BASI_HUMAN Isoform 2 of Basigin

7daa[2] C Heavy chain of antibody Fab fragment[212 aa] A 100.0
/98.8 7
/7 BASI_HUMAN Isoform 2 of Basigin

7dce[1] B XKR8_HUMAN XK-related protein 8[354 aa] A 100.0
/98.5 12
/12 BASI_HUMAN Isoform 2 of Basigin

7y1b[1] B Heavy chain of 6E7F1[214 aa] A 40.0
/50.0 10
/11 BASI_MOUSE Isoform 2 of Basigin

7y1b[1] C Light chain of 6E7F1[213 aa] A 22.2
/50.0 9
/10 BASI_MOUSE Isoform 2 of Basigin

6a69[1] A AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1[911 .. B 75.0
/47.2 16
/16 NPTN_HUMAN Neuroplastin

6lyy[5] A MOT1_HUMAN Monocarboxylate transporter 1[382 aa] B 100.0
/100.0 10
/10 BASI_HUMAN Basigin

7yr5[1] B MOT1_HUMAN Monocarboxylate transporter 1[385 aa] A 56.2
/38.6 16
/16 EMB_HUMAN Embigin

7o52[1] A m971 Fab Heavy chain[227 aa] C 20.0
/30.3 15
/15 CD22 d6-d7 Ig domains

7o52[1] B m971 Fab Light chain[215 aa] C 33.3
/30.3 6
/6 CD22 d6-d7 Ig domains

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

2wv3[1] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/35.8 3
/6 NPTN_RAT NEUROPLASTIN

2wv3[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 60.0
/35.8 5
/5 NPTN_RAT NEUROPLASTIN

5k6z[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/29.6 2
/2 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera

5k6z[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/29.6 1
/1 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera

6a69[1] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 75.0
/47.2 4
/4 NPTN_HUMAN Neuroplastin

6dld[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/30.6 2
/2 IGLO5_HUMAN IgLON family member 5

6dle[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. B 100.0
/30.6 1
/1 IGLO5_HUMAN IgLON family member 5

6zr7[1] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 50.0
/40.5 2
/2 DSCAM_HUMAN Down syndrome cell adhesion molecule

7o52[1] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 0.0
/30.3 2
/2 CD22 d6-d7 Ig domains

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7daa[1] D CD
CADMIUM ION[1 atoms] A 100.0
/98.8 1
/1 BASI_HUMAN Isoform 2 of Basigin

7daa[1] E CD
CADMIUM ION[1 atoms] A 100.0
/98.8 1
/1 BASI_HUMAN Isoform 2 of Basigin

7daa[1] F CD
CADMIUM ION[1 atoms] A 100.0
/98.8 1
/1 BASI_HUMAN Isoform 2 of Basigin

3i84[4] C CL
CHLORIDE ION[1 atoms] B 100.0
/98.7 1
/1 Q54A51_HUMAN Cervical EMMPRIN

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6zr7[1] B N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galact.. A 0.0
/40.5 1
/8 DSCAM_HUMAN Down syndrome cell adhesion molecule

6zr7[1] C beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-b.. A 0.0
/40.5 6
/6 DSCAM_HUMAN Down syndrome cell adhesion molecule

7ok5[1] D alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 0.0
/36.1 1
/7 Neurofascin 155

7ok5[2] E beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 0.0
/36.1 5
/7 Neurofascin 155

7ok5[2] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/36.1 2
/9 Neurofascin 155

7ol4[1] P alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 0.0
/35.6 6
/6 Neurofascin

7ol4[1] T alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. D 0.0
/35.6 5
/6 Neurofascin

5k6z[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/29.6 2
/2 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3qqn[6] B BASI_HUMAN Basigin[116 aa] A 100.0
/98.3 14
/15 BASI_HUMAN Basigin

3qr2[2] A BASI_HUMAN Basigin[117 aa] A 100.0
/99.1 1
/1 BASI_HUMAN Basigin

3qr2[4] B BASI_HUMAN Basigin[116 aa] A 100.0
/99.1 7
/7 BASI_HUMAN Basigin

3qr2[2] B BASI_HUMAN Basigin[116 aa] B 100.0
/99.1 7
/7 BASI_HUMAN Basigin

3i84[6] A Q54A51_HUMAN Cervical EMMPRIN[79 aa] A 100.0
/98.7 7
/7 Q54A51_HUMAN Cervical EMMPRIN

3i84[4] B Q54A51_HUMAN Cervical EMMPRIN[85 aa] A 100.0
/98.7 36
/36 Q54A51_HUMAN Cervical EMMPRIN

1nbq[2] B JAM1_HUMAN Junctional adhesion molecule 1[208 aa] A 0.0
/32.2 7
/11 JAM1_HUMAN Junctional adhesion molecule 1

5k6z[2] B SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera[378 .. A 16.7
/29.6 6
/27 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

385 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3b5h[1] E ACT
ACETATE ION[4 atoms] D 100.0
/100.0 2
/2 Q54A51_HUMAN Cervical EMMPRIN

7o52[1] D SO4
SULFATE ION[5 atoms] C 0.0
/30.3 1
/1 CD22 d6-d7 Ig domains

7o52[1] J SO4
SULFATE ION[5 atoms] C 50.0
/30.3 2
/2 CD22 d6-d7 Ig domains

7o52[1] K SO4
SULFATE ION[5 atoms] C 0.0
/30.3 3
/3 CD22 d6-d7 Ig domains

7o52[1] L GOL
GLYCEROL[6 atoms] C 0.0
/30.3 3
/3 CD22 d6-d7 Ig domains

5k6z[2] H MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] A 0.0
/29.6 2
/5 SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
385
	pdb_id	a¹	identity[%]²	description
	7cko	B	100.0	BASI_HUMAN Basigin
	3qr2	A	99.1	BASI_HUMAN Basigin
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	4u0q[1]	A	B2L3N7_PLAFA Reticulocyte binding protein 5[286 aa]	B	100.0 /100.0	24 /25	BASI_HUMAN Basigin
	4u0q[1]	C	B2L3N7_PLAFA Reticulocyte binding protein 5[285 aa]	D	100.0 /100.0	20 /21	BASI_HUMAN Basigin
	5x0t[2]	A	6H8 Fab fragment heavy chain[215 aa]	E	100.0 /100.0	9 /9	BASI_HUMAN Basigin
	5x0t[2]	C	6H8 Fab fragment light chain[213 aa]	E	100.0 /100.0	7 /7	BASI_HUMAN Basigin
	7xy8[2]	C	heavy chain[212 aa]	A	100.0 /100.0	15 /15	BASI_HUMAN Isoform 2 of Basigin
	7xy8[2]	E	light chain[214 aa]	A	100.0 /100.0	8 /8	BASI_HUMAN Isoform 2 of Basigin
	7daa[2]	B	Light chain of antibody Fab fragment[217 aa]	A	100.0 /98.8	14 /14	BASI_HUMAN Isoform 2 of Basigin
	7daa[2]	C	Heavy chain of antibody Fab fragment[212 aa]	A	100.0 /98.8	7 /7	BASI_HUMAN Isoform 2 of Basigin
	7dce[1]	B	XKR8_HUMAN XK-related protein 8[354 aa]	A	100.0 /98.5	12 /12	BASI_HUMAN Isoform 2 of Basigin
	7y1b[1]	B	Heavy chain of 6E7F1[214 aa]	A	40.0 /50.0	10 /11	BASI_MOUSE Isoform 2 of Basigin
	7y1b[1]	C	Light chain of 6E7F1[213 aa]	A	22.2 /50.0	9 /10	BASI_MOUSE Isoform 2 of Basigin
	6a69[1]	A	AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1[911 ..	B	75.0 /47.2	16 /16	NPTN_HUMAN Neuroplastin
	6lyy[5]	A	MOT1_HUMAN Monocarboxylate transporter 1[382 aa]	B	100.0 /100.0	10 /10	BASI_HUMAN Basigin
	7yr5[1]	B	MOT1_HUMAN Monocarboxylate transporter 1[385 aa]	A	56.2 /38.6	16 /16	EMB_HUMAN Embigin
	7o52[1]	A	m971 Fab Heavy chain[227 aa]	C	20.0 /30.3	15 /15	CD22 d6-d7 Ig domains
	7o52[1]	B	m971 Fab Light chain[215 aa]	C	33.3 /30.3	6 /6	CD22 d6-d7 Ig domains
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	2wv3[1]	B	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /35.8	3 /6	NPTN_RAT NEUROPLASTIN
	2wv3[1]	C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	60.0 /35.8	5 /5	NPTN_RAT NEUROPLASTIN
	5k6z[1]	D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /29.6	2 /2	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
	5k6z[1]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /29.6	1 /1	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
	6a69[1]	C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	B	75.0 /47.2	4 /4	NPTN_HUMAN Neuroplastin
	6dld[3]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /30.6	2 /2	IGLO5_HUMAN IgLON family member 5
	6dle[1]	I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	B	100.0 /30.6	1 /1	IGLO5_HUMAN IgLON family member 5
	6zr7[1]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	50.0 /40.5	2 /2	DSCAM_HUMAN Down syndrome cell adhesion molecule
	7o52[1]	I	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	C	0.0 /30.3	2 /2	CD22 d6-d7 Ig domains
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7daa[1]	D	CD CADMIUM ION[1 atoms]	A	100.0 /98.8	1 /1	BASI_HUMAN Isoform 2 of Basigin
	7daa[1]	E	CD CADMIUM ION[1 atoms]	A	100.0 /98.8	1 /1	BASI_HUMAN Isoform 2 of Basigin
	7daa[1]	F	CD CADMIUM ION[1 atoms]	A	100.0 /98.8	1 /1	BASI_HUMAN Isoform 2 of Basigin
	3i84[4]	C	CL CHLORIDE ION[1 atoms]	B	100.0 /98.7	1 /1	Q54A51_HUMAN Cervical EMMPRIN
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6zr7[1]	B	N-acetyl-alpha-neuraminic acid-(2-3)-beta-D-galact..	A	0.0 /40.5	1 /8	DSCAM_HUMAN Down syndrome cell adhesion molecule
	6zr7[1]	C	beta-D-galactopyranose-(1-4)-2-acetamido-2-deoxy-b..	A	0.0 /40.5	6 /6	DSCAM_HUMAN Down syndrome cell adhesion molecule
	7ok5[1]	D	alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(..	A	0.0 /36.1	1 /7	Neurofascin 155
	7ok5[2]	E	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	A	0.0 /36.1	5 /7	Neurofascin 155
	7ok5[2]	G	alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose..	B	0.0 /36.1	2 /9	Neurofascin 155
	7ol4[1]	P	alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(..	C	0.0 /35.6	6 /6	Neurofascin
	7ol4[1]	T	alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(..	D	0.0 /35.6	5 /6	Neurofascin
	5k6z[1]	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	0.0 /29.6	2 /2	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3qqn[6]	B	BASI_HUMAN Basigin[116 aa]	A	100.0 /98.3	14 /15	BASI_HUMAN Basigin
	3qr2[2]	A	BASI_HUMAN Basigin[117 aa]	A	100.0 /99.1	1 /1	BASI_HUMAN Basigin
	3qr2[4]	B	BASI_HUMAN Basigin[116 aa]	A	100.0 /99.1	7 /7	BASI_HUMAN Basigin
	3qr2[2]	B	BASI_HUMAN Basigin[116 aa]	B	100.0 /99.1	7 /7	BASI_HUMAN Basigin
	3i84[6]	A	Q54A51_HUMAN Cervical EMMPRIN[79 aa]	A	100.0 /98.7	7 /7	Q54A51_HUMAN Cervical EMMPRIN
	3i84[4]	B	Q54A51_HUMAN Cervical EMMPRIN[85 aa]	A	100.0 /98.7	36 /36	Q54A51_HUMAN Cervical EMMPRIN
	1nbq[2]	B	JAM1_HUMAN Junctional adhesion molecule 1[208 aa]	A	0.0 /32.2	7 /11	JAM1_HUMAN Junctional adhesion molecule 1
	5k6z[2]	B	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera[378 ..	A	16.7 /29.6	6 /27	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
385	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3b5h[1]	E	ACT ACETATE ION[4 atoms]	D	100.0 /100.0	2 /2	Q54A51_HUMAN Cervical EMMPRIN
	7o52[1]	D	SO4 SULFATE ION[5 atoms]	C	0.0 /30.3	1 /1	CD22 d6-d7 Ig domains
	7o52[1]	J	SO4 SULFATE ION[5 atoms]	C	50.0 /30.3	2 /2	CD22 d6-d7 Ig domains
	7o52[1]	K	SO4 SULFATE ION[5 atoms]	C	0.0 /30.3	3 /3	CD22 d6-d7 Ig domains
	7o52[1]	L	GOL GLYCEROL[6 atoms]	C	0.0 /30.3	3 /3	CD22 d6-d7 Ig domains
	5k6z[2]	H	MPD (4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms]	A	0.0 /29.6	2 /5	SDK2_MOUSE SDK1_MOUSE Protein sidekick-2,Protein sidekick-1 chimera
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P35613(BASI_HUMAN)]