Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3973821 272 7 P35232(PHB1_HUMAN) RecName: Full=Prohibitin 1 ;
QUERYSEQ 
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV
SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P35232(PHB1_HUMAN)]

272
region name description
2-272 CHAIN /note="Prohibitin 1" /id="PRO_0000213878"
177-211 COILED
1-22 DISORDER predicted by DISOPRED

MONOMER
272
pdb_id a1 identity[%]2 description
8j4i B 58.2 PHB2_HUMAN Prohibitin-2
6iqe A 53.6 PHB2_HUMAN Prohibitin-2 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
272 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8j4i[6] B PHB2_HUMAN Prohibitin-2[190 aa] A 58.3
/58.2		 12
/17		 PHB2_HUMAN Prohibitin-2
8j4i[6] F PHB2_HUMAN Prohibitin-2[190 aa] A 46.2
/58.2		 13
/19		 PHB2_HUMAN Prohibitin-2
6iqe[2] A PHB2_HUMAN Prohibitin-2[59 aa] A 41.2
/53.6		 17
/17		 PHB2_HUMAN Prohibitin-2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.