Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
867903 1130 68 P33076(C2TA_HUMAN) RecName: Full=MHC class II transactivator ; Short=CIITA ; EC=2.3.1.- ; EC=2.7.11.1 ;
QUERYSEQ 
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEEEIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEVGQKSQKRPFPEE
LPADLKHWKPAEPPTVVTGSLLVRPVSDCSTLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGLWQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGILVEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLGKAGQGKSYWAGAVSRAWACGRLPQYDFVFS
VPCHCLNRPGDAYGLQDLLFSLGPQPLVAADEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRGCTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAELAKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGALWLALSGEIKDKELPQYLALTPRKKRPYDNW
LEGVPRFLAGLIFQPPARCLGALLGPSAAASVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRLTPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLEFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITDLGAYKLAEALPSLAASLLRLS
LYNNCICDVGAESLARVLPDMVSLRVMDVQYNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P33076(C2TA_HUMAN)]

1130
region name description
1-1130 CHAIN /note="MHC class II transactivator" /id="PRO_0000089241"
414-724 DOMAIN /note="NACHT"
985-1008 REPEAT /note="LRR 1"
1016-1037 REPEAT /note="LRR 2"
1045-1066 REPEAT /note="LRR 3"
1073-1093 REPEAT /note="LRR 4"
94-132 REGION /note="Required for acetyltransferase activity"
269-303 REGION /note="Disordered"
280-294 COMPBIAS /note="Polar residues"
420-427 BINDING /ligand="GTP" /ligand_id="ChEBI:CHEBI:37565"
1-1130 DISORDER predicted by DISOPRED

MONOMER
1130
pdb_id a1 identity[%]2 description
7pzc H 31.5 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
5irm B 34.5 G1T469_RABIT Uncharacterized protein
7wge A 32.7 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N-terminus 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1130 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7wge[1] B A0A2H1VFV3_SPOFR Thioredoxin[106 aa] A 28.6
/32.7		 14
/14		 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
6npy[1] B E2AK2_HUMAN NEK7_HUMAN Protein kinase R,Serine/threonine-protein kinase N.. A 20.0
/32.4		 5
/29		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
8ej4[10] K NEK7_HUMAN Serine/threonine-protein kinase Nek7[261 aa] A 14.3
/31.7		 7
/13		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1130 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7vtp[6] H 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. 		A 46.2
/32.5		 13
/13		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7vtq[12] N 7YN
1-[4-(2-oxidanylpropan-2-yl)furan-2-yl]sulfonyl-3-.. 		A 58.3
/33.0		 12
/12		 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
5irl[4] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 57.1
/33.9		 14
/17		 G1T469_RABIT Uncharacterized protein
6npy[11] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 44.4
/32.4		 9
/12		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7alv[1] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 53.8
/31.7		 13
/18		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7vtp[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 50.0
/32.5		 12
/16		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7vtq[12] M ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 42.9
/33.0		 14
/18		 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
7wbt[2] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 50.0
/33.1		 12
/19		 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
7wbu[2] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 55.6
/33.1		 9
/15		 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
7zgu[6] G ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		A 63.6
/32.4		 11
/15		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
8etr[1] D WTN
(6S,8R)-N-[(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)c.. 		A 50.0
/31.8		 14
/14		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7alv[1] B RM5
1-[4-chloranyl-2,6-di(propan-2-yl)phenyl]-3-[4-(2-.. 		A 56.2
/31.7		 16
/18		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7wge[1] C AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. 		A 88.9
/32.7		 9
/17		 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
8ej4[10] U AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom.. 		A 61.5
/31.7		 13
/19		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7pzc[10] L 8GI
1-(1,2,3,5,6,7-hexahydro-s-indacen-4-yl)-3-[4-(2-o.. 		A 40.0
/31.5		 15
/15		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1130 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7wge[1] D MG
MAGNESIUM ION[1 atoms] 		A 100.0
/32.7		 2
/2		 NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1, N..
8ej4[11] V MG
MAGNESIUM ION[1 atoms] 		A 66.7
/31.7		 3
/3		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1130 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5irm[1] B G1T469_RABIT Uncharacterized protein[770 aa] A 40.0
/34.5		 10
/23		 G1T469_RABIT Uncharacterized protein
7wbt[2] B NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9[89.. A 16.7
/33.1		 12
/31		 NLRP9_BOVIN NACHT, LRR and PYD domains-containing protein 9
7lfh[12] L NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[80.. A 0.0
/33.2		 3
/20		 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
7vtq[12] H NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3[78.. A 0.0
/33.0		 2
/17		 NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3
7vtp[2] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 100.0
/32.5		 1
/5		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7vtp[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[79.. A 66.7
/32.5		 3
/7		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7zgu[6] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 50.0
/32.4		 2
/8		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7zgu[6] C NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[80.. A 50.0
/32.4		 2
/8		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
8ej4[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 22.2
/31.7		 9
/17		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
8ej4[10] J NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[85.. A 33.3
/31.7		 6
/18		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
7pzc[10] B NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3[88.. A 50.0
/31.5		 6
/13		 NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.