Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4012339 1187 500 P29597(TYK2_HUMAN) RecName: Full=Non-receptor tyrosine-protein kinase TYK2; EC=2.7.10.2 ;
QUERYSEQ
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHIAHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREPAVYRCGPPGTEASSDQTAQGMQLLDPASFE
YLFEQGKHEFVNDVASLWELSTEEEIHHFKNESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRRFLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLVDGYFRLTADSSHYLCHEVAPPRLVMSIRDG
IHGPLLEPFVQAKLRPEDGLYLIHWSTSHPYRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRAGDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETASLMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLASALSYLENKNLVHGNVCGRNILLARLGLAEG
TSPFIKLSDPGVGLGALSREERVERIPWLAPECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQLATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPE
GHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P29597(TYK2_HUMAN)]

1187
region name description
1-1187 CHAIN /note="Non-receptor tyrosine-protein kinase TYK2" /id="PRO_0000088177"
26-431 DOMAIN /note="FERM"
450-529 DOMAIN /note="SH2; atypical"
589-875 DOMAIN /note="Protein kinase 1"
897-1176 DOMAIN /note="Protein kinase 2"
335-366 REGION /note="Disordered"
610-629 REGION /note="Disordered"
1023-1023 ACT_SITE /note="Proton acceptor" ECO:0000255|PROSITE-ProRule:PRU10028"
903-911 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
930-930 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
1-1187 DISORDER predicted by DISOPRED

MONOMER
1187
pdb_id a1 identity[%]2 description
4oli A 99.6 TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8ewy B 51.5 B1ASP2_MOUSE Tyrosine-protein kinase
4po6 A 100.0 TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1187 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4po6[1] B INAR1_HUMAN Interferon alpha/beta receptor 1[19 aa] A 100.0
/100.0
30
/30
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6c7y[1] B B6RCQ2_CHICK Suppressor of cytokine signaling 1[117 aa] A 53.6
/61.5
28
/28
JAK1_HUMAN Tyrosine-protein kinase JAK1
4gl9[4] G SOCS3_MOUSE Suppressor of cytokine signaling 3,Suppressor of c.. A 50.0
/53.6
20
/21
G5E852_MOUSE Tyrosine-protein kinase
7t6f[4] B INLR1_MOUSE Interferon lambda receptor 1[37 aa] A 58.1
/51.5
31
/31
B1ASP2_MOUSE Tyrosine-protein kinase
5ixd[1] B INLR1_HUMAN Interferon lambda receptor 1[21 aa] A 54.2
/47.2
24
/24
JAK1_HUMAN Tyrosine-protein kinase JAK1
5ixi[1] B INLR1_HUMAN I10R1_HUMAN Chimera protein of Interferon lambda receptor 1 an.. A 60.0
/46.4
25
/26
JAK1_HUMAN Tyrosine-protein kinase JAK1
5l04[1] B INLR1_HUMAN Interferon lambda receptor 1[37 aa] A 39.5
/45.5
43
/44
JAK1_HUMAN Tyrosine-protein kinase JAK1
6e2p[2] C LEPR_HUMAN Leptin receptor[20 aa] A 57.9
/36.1
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
6e2q[2] E EPOR_HUMAN Erythropoietin receptor[44 aa] C 37.9
/35.6
29
/29
JAK2_HUMAN Tyrosine-protein kinase JAK2
6e2q[1] F EPOR_HUMAN Erythropoietin receptor[57 aa] A 34.0
/35.7
50
/50
JAK2_HUMAN Tyrosine-protein kinase JAK2
6e2q[1] G EPOR_HUMAN Erythropoietin receptor[52 aa] B 34.0
/35.5
50
/50
JAK2_HUMAN Tyrosine-protein kinase JAK2
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1187 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4wov[2] C 3SM
2-methoxy-N-({6-[1-methyl-4-(methylamino)-1,6-dihy..
A 100.0
/100.0
14
/14
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c03[2] C AGS
PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER[31 atom..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5tkd[3] C 7GL
6-[(3,5-dimethylphenyl)amino]-8-(methylamino)imida..
A 100.0
/100.0
16
/16
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nsl[2] C KZJ
6-{[1-(4-cyanophenyl)-2-oxo-1,2-dihydropyridin-3-y..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nze[2] C L8Y
4-[(2-carbamoylphenyl)amino]-6-[(5-fluoropyridin-2..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzf[2] C L91
6-[(5-fluoropyridin-2-yl)amino]-N-methyl-4-{[2-(me..
A 100.0
/100.0
19
/19
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzh[2] C L9A
6-[(cyclopropanecarbonyl)amino]-N-methyl-4-{[2-(me..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzp[2] C LB7
6-[(cyclopropanecarbonyl)amino]-4-{[2-methoxy-3-(1..
A 100.0
/100.0
19
/19
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzq[2] C LB4
6-[(5-fluoro-4-methylpyridin-2-yl)amino]-4-[(2-met..
A 100.0
/100.0
20
/20
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7ax4[2] C NM7
2-(carbamoylamino)-5-(4-fluorophenyl)thiophene-3-c..
A 100.0
/100.0
15
/15
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7k7o[2] C VZJ
6-[(cyclopropanecarbonyl)amino]-4-{[2-methoxy-3-(p..
A 100.0
/100.0
21
/21
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7k7q[2] C VZG
6-[(cyclopropanecarbonyl)amino]-4-({3-[6-(dimethyl..
A 100.0
/100.0
22
/22
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7uyr[1] B OVI
2-(4-{[2-(2,6-difluorophenyl)-5-oxo-5H-pyrrolo[3,4..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7uys[1] B OVC
2-(2,6-difluorophenyl)-4-(4-methoxyanilino)-5H-pyr..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s98[3] D ZRU
(8S)-N-cyclopropyl-5-[(2-methoxypyridin-3-yl)amino..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s99[3] D ZS3
(8S)-N-[(1R,2S)-2-fluorocyclopropyl]-5-{[(1M,2'M)-..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s9a[3] D ZSB
(8S)-N-[(1R,2R)-2-methoxycyclobutyl]-7-(methylamin..
A 100.0
/100.0
19
/19
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8tb5[2] D ZOQ
N-{(3P)-3-[3-(dimethylsulfamoyl)phenyl]-1H-pyrrolo..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8tb6[2] C ZOI
N-[(3M)-3-{6-[(3R)-3-methoxyoxolan-3-yl]pyridin-2-..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4oli[1] B 2TT
2-chloro-N-{2-[(cyclopropylcarbonyl)amino]pyridin-..
A 100.0
/99.6
15
/15
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4oli[1] C 2TT
2-chloro-N-{2-[(cyclopropylcarbonyl)amino]pyridin-..
A 100.0
/99.6
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzr[2] C LAJ
N-methyl-4-{[2-(methylsulfonyl)phenyl]amino}-6-[(p..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5f20[1] B 5U4
3-azanyl-5-(2-methylphenyl)-7-(1-methylpyrazol-3-y..
A 100.0
/99.3
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6vnv[1] B R4Y
(1S,2S)-2-cyano-N-[(1S,5R)-3-(5-fluoro-2-{[1-(2-hy..
A 100.0
/99.3
20
/20
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6ova[1] B N9G
6-({4-[(3S)-3-cyano-3-cyclopropyl-2-oxopyrrolidin-..
A 100.0
/99.3
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3nyx[1] B TZ1
N-{5-[(7-chloroquinolin-4-yl)sulfanyl]-1,3,4-thiad..
A 100.0
/99.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5f1z[1] B 5U3
3-azanyl-5-[(2~{S})-3-methylbutan-2-yl]-7-[1-methy..
A 100.0
/98.9
15
/15
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gfm[1] B 0X2
2,6-dichloro-N-(2-oxo-2,5-dihydropyridin-4-yl)benz..
A 81.2
/53.5
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
4gfo[1] G 0X2
2,6-dichloro-N-(2-oxo-2,5-dihydropyridin-4-yl)benz..
A 100.0
/98.9
14
/14
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3eyg[3] B MI1
3-{(3R,4R)-4-methyl-3-[methyl(7H-pyrrolo[2,3-d]pyr..
A 89.5
/61.3
19
/19
Q59GQ2_HUMAN Tyrosine-protein kinase
3lxk[1] B MI1
3-{(3R,4R)-4-methyl-3-[methyl(7H-pyrrolo[2,3-d]pyr..
A 66.7
/51.6
21
/21
JAK3_HUMAN Tyrosine-protein kinase JAK3
3lxn[1] B MI1
3-{(3R,4R)-4-methyl-3-[methyl(7H-pyrrolo[2,3-d]pyr..
A 100.0
/98.3
19
/19
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4py1[1] B 2YK
6-[(2,5-dimethoxyphenyl)sulfanyl]-3-(1-methyl-1H-p..
A 100.0
/97.9
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6dbk[1] B G5D
4-({4-[(1S,4S)-5-(cyanoacetyl)-2,5-diazabicyclo[2...
A 100.0
/97.9
20
/20
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6vns[1] B R5D
(1R,2R)-2-cyano-N-[(1S,5R)-3-(5-fluoro-2-{[1-(2-hy..
A 100.0
/97.9
22
/22
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6vnx[1] B R4V
(1S)-2,2-difluoro-N-[(1S,5R,6R)-3-{5-fluoro-2-[(1-..
A 100.0
/97.9
21
/21
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6x8e[2] C UWP
[3-{4-[6-(1-methyl-1H-pyrazol-4-yl)pyrazolo[1,5-a]..
A 84.2
/52.5
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
6x8f[2] C UWP
[3-{4-[6-(1-methyl-1H-pyrazol-4-yl)pyrazolo[1,5-a]..
A 100.0
/98.9
21
/21
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6x8g[1] B UWM
trans-3-(cyanomethyl)-3-{4-[6-(1-methyl-1H-pyrazol..
A 100.0
/97.9
20
/20
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gii[1] B 0X6
2,6-dichloro-4-cyano-N-{2-[(cyclopropylcarbonyl)am..
A 100.0
/97.6
16
/16
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gj2[1] B 0XH
2,6-dichloro-N-[2-({[(1R,2R)-2-fluorocyclopropyl]c..
A 100.0
/97.6
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gj3[1] B 0XP
2,6-dichloro-4-cyano-N-[2-({[(1R,2R)-2-fluorocyclo..
A 100.0
/97.6
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6aah[3] C 9T6
4-[[(1S,3R)-5-oxidanyl-2-adamantyl]amino]-1H-pyrro..
A 80.0
/61.0
15
/15
JAK1_HUMAN Tyrosine-protein kinase JAK1
6aaj[2] C 9T6
4-[[(1S,3R)-5-oxidanyl-2-adamantyl]amino]-1H-pyrro..
A 81.8
/53.8
11
/11
JAK2_HUMAN Tyrosine-protein kinase JAK2
6aak[4] E 9T6
4-[[(1S,3R)-5-oxidanyl-2-adamantyl]amino]-1H-pyrro..
A 83.3
/51.3
12
/12
JAK3_HUMAN Tyrosine-protein kinase JAK3
4e20[1] B 0MY
N-[4-(3-amino-1H-indazol-5-yl)phenyl]-3-chlorobenz..
A 100.0
/91.8
17
/17
TYK2_MOUSE Non-receptor tyrosine-protein kinase TYK2
4e1z[1] B 0MX
N-[5-(4-{[(3-chlorophenyl)sulfonyl]amino}phenyl)-1..
A 100.0
/91.3
21
/21
TYK2_MOUSE Non-receptor tyrosine-protein kinase TYK2
6n7c[2] C KF1
N-[5-(3-methoxynaphthalen-2-yl)-1H-pyrazol-4-yl]py..
A 78.9
/62.2
19
/19
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n77[2] C KEJ
N-[3-(5-chloro-2-methoxyphenyl)-1-methyl-1H-pyrazo..
A 82.4
/61.6
17
/17
JAK1_HUMAN Tyrosine-protein kinase JAK1
6tpf[2] C NTQ
(1~{S})-2,2-bis(fluoranyl)-~{N}-[4-(3-methyl-6-oxi..
A 88.9
/60.7
18
/18
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n78[1] B KEP
N-{3-[5-chloro-2-(difluoromethoxy)phenyl]-1-methyl..
A 81.0
/61.9
21
/21
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n79[1] B KES
N-{5-[5-chloro-2-(difluoromethoxy)phenyl]-1H-pyraz..
A 81.0
/61.8
21
/21
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n7b[1] B KEY
N-[3-(5-chloro-2-methoxyphenyl)-1-methyl-1H-pyrazo..
A 84.2
/61.8
19
/19
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n7d[1] B KF4
N-[5-(6-methoxy-1H-indazol-5-yl)-1H-pyrazol-4-yl]p..
A 81.0
/61.8
21
/21
JAK1_HUMAN Tyrosine-protein kinase JAK1
4e5w[2] C 0NT
[4-(imidazo[4,5-d]pyrrolo[2,3-b]pyridin-1(6H)-yl)p..
A 83.3
/58.9
18
/18
JAK1_HUMAN Tyrosine-protein kinase JAK1
4k6z[1] B 1Q3
(1R,2S)-2-{[8-oxo-2-(1H-pyrazol-4-yl)-5,8-dihydrop..
A 82.4
/61.6
17
/17
JAK1_HUMAN Tyrosine-protein kinase JAK1
6rsb[2] C KGZ
1-[(3~{R},4~{R})-4-(cyanomethyl)-1-[[4-(cyclohexen..
A 87.0
/60.8
23
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
6rsc[2] C KH5
1-[4-(cyanomethyl)-1-[(4-phenylphenyl)methyl]piper..
A 86.4
/60.8
22
/22
JAK1_HUMAN Tyrosine-protein kinase JAK1
6rsd[2] C KH8
1-[4-(cyanomethyl)-1-[(3-oxidanyl-4-phenyl-phenyl)..
A 87.0
/60.8
23
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
6rse[2] C KHH
methyl ~{N}-[4-aminocarbonyl-1-[(3~{R},4~{R})-4-(c..
A 85.7
/60.8
21
/21
JAK1_HUMAN Tyrosine-protein kinase JAK1
6rsh[2] C KHE
1-[(3~{R},4~{R})-4-(cyanomethyl)-3-fluoranyl-1-[(4..
A 82.6
/60.8
23
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
6smb[2] C LKQ
~{N}-[3-[2-[(3-methoxy-1-methyl-pyrazol-4-yl)amino..
A 82.6
/60.6
23
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
6ggh[2] C EYQ
~{N}-[5-methyl-4-[7-[[(2~{R})-2-(4-methylpiperazin..
A 83.3
/60.8
18
/18
JAK1_HUMAN Tyrosine-protein kinase JAK1
4e4n[2] C 0NL
tert-butyl [(1R,3R)-3-(imidazo[4,5-d]pyrrolo[2,3-b..
A 89.5
/59.1
19
/19
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ei4[2] C 0Q2
(1R,3R)-3-(2-methylimidazo[4,5-d]pyrrolo[2,3-b]pyr..
A 78.6
/59.5
14
/14
JAK1_HUMAN Tyrosine-protein kinase JAK1
4iva[1] B 1J5
trans-4-{2-[(1R)-1-hydroxyethyl]imidazo[4,5-d]pyrr..
A 93.8
/51.2
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
4ivb[2] C 1J5
trans-4-{2-[(1R)-1-hydroxyethyl]imidazo[4,5-d]pyrr..
A 82.4
/59.1
17
/17
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ivc[2] C 1J6
(trans-4-{2-[(1R)-1-hydroxyethyl]imidazo[4,5-d]pyr..
A 83.3
/59.1
18
/18
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ivd[2] C 15T
3-(trans-4-{2-[(1R)-1-hydroxyethyl]imidazo[4,5-d]p..
A 85.0
/59.3
20
/20
JAK1_HUMAN Tyrosine-protein kinase JAK1
4k77[2] C 1Q4
4-(cyclohexylamino)pyrido[3,4-d]pyrimidin-8(7H)-on..
A 83.3
/61.1
12
/12
JAK1_HUMAN Tyrosine-protein kinase JAK1
5e1e[2] D 5JG
6-chloro-2-(2-fluoro-4,5-dimethoxyphenyl)-N-(piper..
A 80.0
/61.6
15
/15
JAK1_HUMAN Tyrosine-protein kinase JAK1
5wo4[2] C B7V
3-[(4-chloro-3-methoxyphenyl)amino]-1-[(3R,4S)-4-c..
A 82.4
/58.9
17
/17
JAK1_HUMAN Tyrosine-protein kinase JAK1
6elr[2] C BFK
[3-[[5-methyl-2-[[3-(4-methylpiperazin-1-yl)-5-met..
A 77.8
/58.8
18
/18
JAK1_HUMAN Tyrosine-Protein Kinase JAK1
6tpe[2] C NTW
2-[4-(3-methyl-6-oxidanylidene-1,7-dihydropyrazolo..
A 85.7
/61.1
14
/14
JAK1_HUMAN Tyrosine-protein kinase JAK1
5hx8[2] C 66P
4-[(4-aminocyclohexyl)amino]-3-(1H-benzimidazol-2-..
A 80.0
/60.4
15
/15
JAK1_HUMAN Tyrosine-protein kinase JAK1
6vny[1] B R4S
N-[(1S,5R)-3-(5-fluoro-2-{[1-(2-hydroxyethyl)-1H-p..
A 100.0
/97.9
20
/20
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6w8l[1] B R4S
N-[(1S,5R)-3-(5-fluoro-2-{[1-(2-hydroxyethyl)-1H-p..
A 85.0
/61.2
20
/20
JAK1_HUMAN Tyrosine-protein kinase JAK1
6hzu[2] C GYQ
2-[4-[8-oxidanylidene-2-[(~{E})-(2-oxidanylidenepy..
A 85.7
/58.9
21
/21
JAK1_HUMAN Tyrosine-protein kinase JAK1
6dbm[1] B G4J
[(1S)-2,2-difluorocyclopropyl][(1R,5S)-3-{2-[(1-me..
A 100.0
/98.2
22
/22
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6dbn[1] B G4J
[(1S)-2,2-difluorocyclopropyl][(1R,5S)-3-{2-[(1-me..
A 84.2
/61.0
19
/19
JAK1_HUMAN Tyrosine-protein kinase JAK1
6sm8[2] C LKT
2-chloranyl-6-[(3~{S})-3-[(1~{S})-2-cyano-1-[4-(7~..
A 87.0
/58.2
23
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
4fk6[2] C 0UJ
N-({1-[(1R,2R,4S)-bicyclo[2.2.1]hept-2-yl]-1,6-dih..
A 81.2
/60.3
16
/16
JAK1_HUMAN Tyrosine-protein kinase JAK1
5khx[1] B 6TE
~{N}-[3-[methyl(7~{H}-pyrrolo[2,3-d]pyrimidin-4-yl..
A 78.6
/60.2
14
/14
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n7a[2] E KEV
N-[3-(5-chloro-2-methoxyphenyl)-1-methyl-1H-pyrazo..
A 84.2
/62.3
19
/19
JAK1_HUMAN Tyrosine-protein kinase JAK1
4i5c[2] C C5I
3-oxo-3-[(3R)-3-(pyrrolo[2,3-b][1,2,3]triazolo[4,5..
A 85.0
/61.6
20
/20
JAK1_HUMAN Tyrosine-protein kinase JAK1
3zmm[2] C F9J
5-FLUORO-4-[(1S)-1-(5-FLUOROPYRIMIDIN-2-YL)ETHOXY]..
A 87.5
/53.7
16
/16
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4c61[2] C LMM
N2-[(1S)-1-(5-fluoropyrimidin-2-yl)ethyl]-7-methyl..
A 86.7
/53.9
15
/15
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4c62[2] C XWW
N2-[(1S)-1-(5-fluoropyrimidin-2-yl)ethyl]-n4-(1-me..
A 82.4
/53.7
17
/17
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
2xa4[2] C AZ5
5-CHLORO-N2-[(1S)-1-(5-FLUOROPYRIMIDIN-2-YL)ETHYL]..
A 86.7
/53.6
15
/15
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
3ugc[1] B 046
5-{[6-(acetylamino)pyrimidin-4-yl]oxy}-N-{4-[(4-me..
A 92.3
/53.8
26
/26
JAK2_HUMAN Tyrosine-protein kinase JAK2
7rn6[1] B 046
5-{[6-(acetylamino)pyrimidin-4-yl]oxy}-N-{4-[(4-me..
A 92.6
/54.5
27
/27
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vn8[2] C 3JW
Baricitinib[26 atoms]
A 78.9
/53.3
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
6wto[1] D 3JW
Baricitinib[26 atoms]
A 77.8
/54.3
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
7teu[1] B I6C
3-{(4S)-2-[(cyclopropanecarbonyl)amino]imidazo[1,2..
A 91.7
/53.8
24
/24
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g6z[2] C YSI
(3R)-3-cyclopentyl-3-[(4M)-4-{5-methyl-2-[(1-methy..
A 88.9
/53.8
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
4d1s[1] B BJG
2-(5-chloro-2-methylphenyl)-1-methyl-5-(2-{[4-(4-m..
A 76.5
/53.8
17
/17
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
5aep[1] B QUP
1-(5-chloro-2-methylphenyl)-4-(pyrrolo[2,1-f][1,2,..
A 77.8
/53.7
18
/18
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
6wtq[1] B U8J
N-methyl-4-{[4-(1-propyl-1H-pyrazol-4-yl)-7H-pyrro..
A 86.7
/53.7
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
4d0w[1] C VVQ
5-(2-aminopyrimidin-4-yl)-2-(5-chloro-2-methylphen..
A 80.0
/53.6
15
/15
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
7ree[1] B 4LY
[3-(4-{2-[3,5-difluoro-4-(1-methyl-1,2,3,6-tetrahy..
A 81.0
/53.6
21
/21
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vne[2] C 2TA
N-tert-butyl-3-{[5-methyl-2-({4-[2-(pyrrolidin-1-y..
A 81.2
/53.3
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
2b7a[8] C IZA
2-TERT-BUTYL-9-FLUORO-3,6-DIHYDRO-7H-BENZ[H]-IMIDA..
A 81.2
/51.4
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
3lxl[1] B IZA
2-TERT-BUTYL-9-FLUORO-3,6-DIHYDRO-7H-BENZ[H]-IMIDA..
A 81.2
/52.0
16
/16
JAK3_HUMAN Tyrosine-protein kinase JAK3
3lxp[1] B IZA
2-TERT-BUTYL-9-FLUORO-3,6-DIHYDRO-7H-BENZ[H]-IMIDA..
A 100.0
/98.2
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3e62[1] B 5B1
5-bromo-1H-indazol-3-amine[11 atoms]
A 88.9
/53.5
9
/9
JAK2_HUMAN Tyrosine-protein kinase JAK2
3e63[1] B 5B2
5-phenyl-1H-indazol-3-amine[16 atoms]
A 84.6
/53.5
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
3e64[1] B 5B3
4-(3-amino-1H-indazol-5-yl)-N-tert-butylbenzenesul..
A 82.4
/53.5
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
4d0x[1] B 953
5-(2-aminopyrimidin-4-yl)-2-[2-chloro-5-(trifluoro..
A 81.2
/53.5
16
/16
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
8bxc[2] C S4R
Itacitinib[40 atoms]
A 82.6
/51.4
23
/23
JAK2_HUMAN Tyrosine-protein kinase JAK2
3io7[1] B 1P5
(3S)-1-[6-(2-aminopyrazolo[1,5-a]pyrimidin-3-yl)py..
A 88.2
/53.4
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
3jy9[1] B JZH
(3S)-3-(4-hydroxyphenyl)-1,5-dihydro-1,5,12-triaza..
A 85.7
/53.4
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
4yti[1] B VJK
(2R)-2-methyl-2-[[2-(1H-pyrrolo[2,3-b]pyridin-3-yl..
A 81.2
/53.3
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
5wal[1] B 9ZS
N-[2-(2,6-dichlorophenyl)-1H-imidazo[4,5-c]pyridin..
A 100.0
/97.6
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5wev[1] B 9ZS
N-[2-(2,6-dichlorophenyl)-1H-imidazo[4,5-c]pyridin..
A 90.0
/53.3
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
4bbe[4] E 3O4
N-[4-[2-[(4-morpholin-4-ylphenyl)amino]pyrimidin-4..
A 91.7
/53.3
12
/12
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4bbf[4] E O19
(2R)-N-[4-[2-[(4-morpholin-4-ylphenyl)amino]pyrimi..
A 82.4
/53.3
17
/17
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
5tq5[1] B 7GX
6-(2-ethyl-4-hydroxyphenyl)-N-(6-methylpyridin-3-y..
A 94.1
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
5tq8[1] B 7GS
{2-[6-(2-ethyl-5-fluoro-4-hydroxyphenyl)-2H-indazo..
A 80.0
/53.3
20
/20
JAK2_HUMAN Tyrosine-protein kinase JAK2
4ytf[1] B 4HZ
N~2~-[2-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)-5..
A 82.4
/53.2
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
3iok[1] B 1P6
3-(6-{[(1S)-1-(4-fluorophenyl)ethyl]amino}pyrimidi..
A 81.2
/53.1
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
3kck[1] B 3KC
3-chloro-4-(4H-3,4,7-triazadibenzo[cd,f]azulen-6-y..
A 86.7
/53.1
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
4yth[1] B 467
N~2~-[2-(5-chloro-1H-pyrrolo[2,3-b]pyridin-3-yl)-5..
A 82.4
/53.1
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6bbu[1] B D7D
N-{cis-3-[methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)a..
A 76.5
/61.0
17
/17
JAK1_HUMAN Tyrosine-protein kinase JAK1
6bbv[1] B D7D
N-{cis-3-[methyl(7H-pyrrolo[2,3-d]pyrimidin-4-yl)a..
A 82.4
/53.1
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
7uyu[2] B OV0
2-(2,6-difluorophenyl)-4-[4-(pyrrolidine-1-carbony..
A 100.0
/100.0
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7q7i[1] B 9I8
4-[8-methoxy-2-[(1-methylpyrazol-4-yl)amino]quinaz..
A 92.9
/53.1
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
7q7k[1] B 9I5
4-(2-azanyl-8-methoxy-quinazolin-6-yl)phenol[20 at..
A 92.3
/53.1
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
7q7w[1] B 9HR
4-[2-[5-(dimethylamino)pentylamino]-8-[[(2~{S})-1-..
A 81.0
/53.1
21
/21
JAK2_HUMAN Tyrosine-protein kinase JAK2
6dud[1] B HB4
N-[(1S)-6-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)-2,3-di..
A 83.3
/53.0
12
/12
JAK3_HUMAN Tyrosine-protein kinase JAK3
8g8x[2] C YT8
3-cyclopropyl-1-{5-methyl-2-[(3-methyl-1,2-thiazol..
A 92.3
/53.8
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
4ytc[1] B 4HW
N~3~-phenyl-1-[6-(phenylamino)pyrimidin-4-yl]-1H-1..
A 83.3
/53.0
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
6hzv[4] E GYW
3-[7-(2-hydroxyethyl)-9-(oxan-4-yl)-8-oxidanyliden..
A 80.0
/52.3
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
5l3a[1] B 6DP
~{N}-(1~{H}-indazol-4-yl)methanesulfonamide[14 ato..
A 88.9
/52.9
9
/9
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g8o[2] C YT0
[1-{5-methyl-2-[(3-methyl-1,2-thiazol-5-yl)amino]p..
A 81.2
/53.6
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
6db3[1] B G54
[(1S)-1-methyl-6-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)..
A 80.0
/52.8
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
7q7l[1] B 9I2
4-[2-azanyl-8-[[(2~{S})-1-oxidanylpropan-2-yl]amin..
A 89.5
/52.8
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
5tq6[2] C 7GV
{(3R,4R)-4-methyl-3-[methyl(7H-pyrrolo[2,3-d]pyrim..
A 88.9
/52.5
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
5tts[1] B 7KU
1-{(3R)-3-[(7H-pyrrolo[2,3-d]pyrimidin-4-yl)amino]..
A 78.6
/52.6
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
6db4[1] B G4Y
N-[(1S)-6-(5-phenyl-7H-pyrrolo[2,3-d]pyrimidin-4-y..
A 73.3
/52.6
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
3zc6[4] E VFC
N-[(2R)-1-(3-cyanoazetidin-1-yl)-1-oxidanylidene-p..
A 76.2
/50.9
21
/21
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
3zep[4] E 1NX
2-[[(3R)-3-acetamido-2,3-dihydro-1H-inden-5-yl]oxy..
A 73.7
/52.2
19
/19
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
4hvi[1] B 19S
2-cyclopropyl-N-[(2R)-1-oxo-1-(piperidin-1-yl)prop..
A 76.5
/52.4
17
/17
JAK3_HUMAN Tyrosine-protein kinase JAK3
4qt1[1] B 3C9
1-{(3S)-1-[(2-methylpropyl)sulfonyl]piperidin-3-yl..
A 75.0
/52.4
16
/16
JAK3_HUMAN Tyrosine-protein kinase JAK3
6tpd[1] B QZ8
3-methyl-4-phenyl-2,7-dihydropyrazolo[3,4-b]pyridi..
A 88.9
/52.4
9
/9
JAK2_HUMAN Tyrosine-protein kinase JAK2
4qps[2] C 37Q
N-{1-[6-(phenylamino)pyrazin-2-yl]-1H-benzimidazol..
A 80.0
/51.9
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
6wtp[1] B U8P
tert-butyl 4-[(4-{1-[3-(cyanomethyl)-1-(ethylsulfo..
A 85.7
/52.2
21
/21
JAK2_HUMAN Tyrosine-protein kinase JAK2
7apg[4] E RQT
~{N}-[3-(1~{H}-pyrrolo[2,3-b]pyridin-3-yl)phenyl]p..
A 83.3
/52.6
12
/12
JAK3_HUMAN Tyrosine-protein kinase JAK3
4hvh[1] B 19R
2-cyclopropyl-N-[(2R)-3-hydroxy-3-methylbutan-2-yl..
A 73.3
/52.2
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
5ttv[1] B 7KX
N-[3-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)phenyl]propa..
A 83.3
/52.2
12
/12
JAK3_HUMAN Tyrosine-protein kinase JAK3
5tq7[2] C 7GT
{(3R,4R)-4-methyl-3-[methyl(7H-pyrrolo[2,3-d]pyrim..
A 84.2
/51.8
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
4hvd[1] C 933
2-cyclopropyl-N-[(2S)-3,3-dimethylbutan-2-yl]-5H-p..
A 80.0
/52.0
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
4i6q[1] C 1DT
N-[(1S)-1-cyclopropylethyl]-2-phenoxy-5H-pyrrolo[2..
A 78.6
/52.0
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
3lpb[2] C NVB
N-methyl-4-[3-(3,4,5-trimethoxyphenyl)quinoxalin-5..
A 83.3
/53.8
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
5cf8[2] C 50V
N,N-dicyclopropyl-4-[(1,5-dimethyl-1H-pyrazol-3-yl..
A 88.2
/51.6
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
5wfj[1] B 9Z4
4-({[3-(propanoylamino)phenyl]methyl}amino)pyrrolo..
A 80.0
/51.9
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
4z16[4] E 4LH
N-(3-{[(5-chloro-2-{[2-methoxy-4-(4-methylpiperazi..
A 80.0
/51.9
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
7uyt[1] B OV5
6-{[(2M)-2-(2-chloro-6-fluorophenyl)-5-oxo-5H-pyrr..
A 100.0
/100.0
18
/18
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7uyv[4] E OV5
6-{[(2M)-2-(2-chloro-6-fluorophenyl)-5-oxo-5H-pyrr..
A 76.9
/51.8
13
/13
JAK3_HUMAN Tyrosine-protein kinase JAK3
5ttu[1] B 7KV
1-[(3aR,7aR)-1-(7H-pyrrolo[2,3-d]pyrimidin-4-yl)oc..
A 73.3
/51.9
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
4hvg[1] B 19Q
2-cyclopropyl-N-[(2S)-3-hydroxy-3-methylbutan-2-yl..
A 80.0
/51.8
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
5toz[1] B 7H4
1-{(2S,5R)-2-methyl-5-[(7H-pyrrolo[2,3-d]pyrimidin..
A 78.6
/51.8
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
4hvd[2] B PHU
1-phenylurea[10 atoms]
A 88.9
/52.0
9
/9
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwm[14] C PHU
1-phenylurea[10 atoms]
A 88.9
/50.9
9
/9
JAK3_HUMAN Tyrosine-protein kinase JAK3
7q6h[1] D PHU
1-phenylurea[10 atoms]
A 88.9
/51.8
9
/9
JAK3_HUMAN Tyrosine-protein kinase JAK3
6da4[1] B G4V
(Z)-1-{2,2-difluoro-6-[5-(2-methoxyethyl)-7H-pyrro..
A 76.9
/51.8
13
/13
JAK3_HUMAN Tyrosine-protein kinase JAK3
7q6h[1] B 934
1-[4-[[2-[(1-methylpyrazol-4-yl)amino]quinazolin-8..
A 78.6
/51.8
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
3tjc[2] C 0TP
4-amino-N-methyl-2-[4-(morpholin-4-yl)phenyl]thien..
A 86.7
/51.4
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
3tjd[2] C 6TP
4-amino-2-[4-(tert-butylsulfamoyl)phenyl]-N-methyl..
A 80.0
/51.4
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
4hge[2] C 15V
N-[1-(3-chlorophenyl)-3-methyl-1H-pyrazol-5-yl]pyr..
A 86.7
/51.4
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
5cf6[2] C 50O
N,N-dicyclopropyl-6-[(2S)-2,3-dihydroxypropyl]-1-m..
A 88.2
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
5w86[4] E 9YV
4-(benzylamino)-6-({4-[(1-methylpiperidin-4-yl)car..
A 71.4
/50.9
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
4e6d[2] C 0NU
3-[(3R)-3-(imidazo[4,5-d]pyrrolo[2,3-b]pyridin-1(6..
A 75.0
/51.6
20
/20
JAK2_HUMAN Tyrosine-protein kinase JAK2
5cf4[2] C 50Y
N,N-dicyclopropyl-6-ethyl-4-[(3-methoxypropyl)amin..
A 83.3
/53.6
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
7ll5[1] C Y5G
{1-(ethylsulfonyl)-3-[4-(2-{[4-(1-methylpiperidin-..
A 81.0
/51.6
21
/21
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnb[2] C R6P
(3S)-3-cyclopentyl-3-[4-(2-{[4-(piperidin-4-yl)phe..
A 88.2
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnc[4] C R6V
(3R)-3-cyclopentyl-3-[4-(2-{[4-(piperidin-4-yl)phe..
A 78.9
/53.3
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnf[2] C R6S
N~4~-[1-(tert-butylsulfonyl)-2,3-dihydro-1H-indol-..
A 82.4
/53.5
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnh[2] C XZS
N-{5-[(2-{[3,5-difluoro-4-(1-methylpiperidin-4-yl)..
A 94.1
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnj[2] C R5S
3-[4-(2-{[4-(piperidin-4-yl)phenyl]amino}-6,7-dihy..
A 87.5
/53.3
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnl[4] E 5W2
4-[[4-[[3-(~{tert}-butylsulfonylamino)-4-chloranyl..
A 87.5
/53.3
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vnm[2] C R5Y
4-[1-(but-3-en-1-yl)-1H-pyrazol-4-yl]-N-[4-(piperi..
A 82.4
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vsn[4] E RG4
(3S)-3-cyclopentyl-3-[4-(7H-pyrrolo[2,3-d]pyrimidi..
A 86.7
/53.3
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
7ll4[1] B Y5D
{1-(ethylsulfonyl)-3-[4-(2-{[3-fluoro-4-(1-methylp..
A 81.0
/51.5
21
/21
JAK2_HUMAN Tyrosine-protein kinase JAK2
5vo6[1] B 9J4
4-{[(1R,3S)-3-amino-2,2,3-trimethylcyclopentyl]ami..
A 81.2
/51.5
16
/16
JAK3_HUMAN Tyrosine-protein kinase JAK3
4gvj[1] B ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/97.9
16
/16
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5khw[2] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 75.0
/61.4
16
/16
JAK1_HUMAN Tyrosine-protein kinase JAK1
6c7y[1] C ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 83.3
/61.5
18
/18
JAK1_HUMAN Tyrosine-protein kinase JAK1
7t6f[4] F ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 83.3
/51.5
12
/12
B1ASP2_MOUSE Tyrosine-protein kinase
7t6f[4] E ADN
ADENOSINE[19 atoms]
A 80.0
/51.5
5
/5
B1ASP2_MOUSE Tyrosine-protein kinase
7apf[2] C RQZ
3-[3-(propanoylamino)phenyl]-1~{H}-pyrrolo[2,3-b]p..
A 75.0
/50.9
12
/12
JAK3_HUMAN Tyrosine-protein kinase JAK3
2w1i[1] C L0I
4-[(2-{4-[(CYCLOPROPYLCARBAMOYL)AMINO]-1H-PYRAZOL-..
A 83.3
/51.4
12
/12
JAK2_HUMAN JAK2
3rvg[1] B 17P
1-(cyclohexylamino)-7-(1-methyl-1H-pyrazol-4-yl)-5..
A 78.6
/51.4
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
3q32[2] C J2I
2-(2,6-difluoro-4-methoxyphenyl)-1-(4-{4-[(3-methy..
A 85.0
/51.4
20
/20
JAK2_HUMAN Tyrosine-protein kinase JAK2
4aqc[2] C 88A
8-(4-methylsulfonylphenyl)-N-(4-morpholin-4-ylphen..
A 77.8
/51.0
18
/18
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4e4l[3] E 0NH
1-[4-methyl-1-(methylsulfonyl)piperidin-4-yl]-1,6-..
A 87.5
/62.0
16
/16
JAK1_HUMAN Tyrosine-protein kinase JAK1
4e4m[4] E 0NH
1-[4-methyl-1-(methylsulfonyl)piperidin-4-yl]-1,6-..
A 86.7
/51.4
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
4gih[1] B 0X5
2,6-dichloro-N-{2-[(cyclopropylcarbonyl)amino]pyri..
A 100.0
/97.6
17
/17
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gmy[1] B 0X5
2,6-dichloro-N-{2-[(cyclopropylcarbonyl)amino]pyri..
A 92.3
/51.4
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
4jia[1] B 1K3
5-(4-methoxyphenyl)-N-[4-(4-methylpiperazin-1-yl)p..
A 76.9
/51.4
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
4zim[2] C 4OK
3-(3,4-dichlorophenyl)-6-(morpholin-4-ylcarbonyl)-..
A 76.9
/53.3
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
5cf5[2] C 50W
N,N-dicyclopropyl-4-[(4,5-dimethyl-1,3-thiazol-2-y..
A 88.9
/51.2
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vng[2] C R6M
N-{2-fluoro-5-[(2-{[3-fluoro-4-(1-methylpiperidin-..
A 82.4
/53.3
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
5tq3[2] C 7GZ
4-[3-(1H-benzimidazol-2-yl)-1H-indazol-6-yl]-3-eth..
A 88.2
/51.1
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vni[2] C R61
2-{5-[(2-{[3,5-difluoro-4-(1-methylpiperidin-4-yl)..
A 84.2
/53.3
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
6vgl[8] E RXT
(3R)-3-cyclopentyl-3-[4-(7H-pyrrolo[2,3-d]pyrimidi..
A 81.2
/53.3
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
6wtn[1] E RXT
(3R)-3-cyclopentyl-3-[4-(7H-pyrrolo[2,3-d]pyrimidi..
A 82.4
/51.1
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
4rio[1] B 3QX
4-{[(1R,2S)-2-fluoro-2-methylcyclopentyl]amino}pyr..
A 85.7
/51.1
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
4ehz[4] E JAK
2-methyl-1-(piperidin-4-yl)-1,6-dihydroimidazo[4,5..
A 78.6
/60.9
14
/14
JAK1_HUMAN Tyrosine-protein kinase JAK1
4f09[1] B JAK
2-methyl-1-(piperidin-4-yl)-1,6-dihydroimidazo[4,5..
A 84.6
/51.1
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
4f08[2] C 1RS
1-(piperidin-4-yl)-1,6-dihydroimidazo[4,5-d]pyrrol..
A 90.9
/51.1
11
/11
JAK2_HUMAN Tyrosine-protein kinase JAK2
6gl9[2] C F3W
(~{E})-3-[3-(3-cyclohexyl-3,5,8,10-tetrazatricyclo..
A 80.0
/51.1
15
/15
JAK3_HUMAN Tyrosine-protein kinase JAK3
4e6q[2] C 0NV
1-(1-benzylpiperidin-4-yl)-1,6-dihydroimidazo[4,5-..
A 78.9
/51.0
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bm2[2] C QQC
3-[(4-chloranyl-2-fluoranyl-phenyl)methyl]-2-methy..
A 81.2
/51.0
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bpv[1] B 6T3
11-(2-pyrrolidin-1-yl-ethoxy)-14,19-dioxa-5,7,26-t..
A 81.2
/51.0
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bpw[2] C 2V9
Lestaurtinib[33 atoms]
A 88.2
/51.0
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bx6[1] B S5I
Cerdulatinib[31 atoms]
A 90.0
/51.0
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bx9[2] C S59
Ilginatinib[29 atoms]
A 78.9
/51.0
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bxh[1] B C87
Momelotinib[31 atoms]
A 81.2
/51.0
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
6gla[2] C F4B
(~{E})-3-[5-(3-cyclohexyl-3,5,8,10-tetrazatricyclo..
A 78.6
/50.9
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
6glb[2] C F48
3-[5-(3-cyclohexyl-3,5,8,10-tetrazatricyclo[7.3.0...
A 71.4
/50.9
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
7c3n[1] B FHX
3-[(3S,4R)-3-methyl-7-(7H-pyrrolo[2,3-d]pyrimidin-..
A 73.7
/50.9
19
/19
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwm[1] B 79T
2-cyano-3-[5-(3-cyclohexyl-3,5,8,10-tetrazatricycl..
A 85.7
/50.9
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwn[1] I 79R
(~{Z})-2-cyano-~{N},~{N}-dimethyl-3-[5-[3-[(1~{S},..
A 78.6
/50.9
14
/14
JAK3_HUMAN Tyrosine-protein kinase JAK3
5tq4[1] B 7GY
6-(2-ethyl-4-hydroxyphenyl)-1H-indazole-3-carboxam..
A 90.0
/50.9
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
4v0g[2] C G9B
N-[3-(2-{3-amino-6-[1-(1-methylpiperidin-4-yl)-1H-..
A 86.7
/51.7
15
/15
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
6ny4[1] B Z3A
4-{[(2R,3R)-1,3-dihydroxybutan-2-yl]amino}-6-pheny..
A 81.2
/50.7
16
/16
JAK3_HUMAN Tyrosine-protein kinase JAK3
3pjc[1] B PJC
3-(1H-indol-3-yl)-4-[2-(4-oxopiperidin-1-yl)-5-(tr..
A 77.8
/50.7
18
/18
JAK3_HUMAN Tyrosine-protein kinase JAK3
4ji9[10] C 1M3
N-tert-butyl-3-[(5-methyl-2-{[4-(4-methylpiperazin..
A 82.4
/51.4
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] G 1M3
N-tert-butyl-3-[(5-methyl-2-{[4-(4-methylpiperazin..
A 90.0
/50.7
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] K 1M3
N-tert-butyl-3-[(5-methyl-2-{[4-(4-methylpiperazin..
A 100.0
/50.7
1
/1
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] N 1M3
N-tert-butyl-3-[(5-methyl-2-{[4-(4-methylpiperazin..
A 25.0
/50.7
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
1yvj[1] B DTV
(2S,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL[8 atoms]
A 70.0
/50.5
10
/10
JAK3_HUMAN Tyrosine-protein kinase JAK3
1yvj[1] C DTV
(2S,3S)-1,4-DIMERCAPTOBUTANE-2,3-DIOL[8 atoms]
A 25.0
/50.5
4
/4
JAK3_HUMAN Tyrosine-protein kinase JAK3
1yvj[1] D 4ST
1,2,3,4-TETRAHYDROGEN-STAUROSPORINE[35 atoms]
A 76.5
/50.5
17
/17
JAK3_HUMAN Tyrosine-protein kinase JAK3
7jyo[1] B VPS
3-({4-amino-6-[(4-cyanophenyl)amino]-1,3,5-triazin..
A 41.7
/49.0
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
6occ[1] C M57
2-[4-({5-amino-3-[(4-sulfamoylphenyl)amino]-1H-1,2..
A 61.1
/47.5
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
6bss[1] C 4SP
O6-CYCLOHEXYLMETHOXY-2-(4'-SULPHAMOYLANILINO) PURI..
A 45.5
/47.4
11
/11
JAK2_HUMAN Tyrosine-protein kinase JAK2
3krr[2] B DQX
8-[3,5-difluoro-4-(morpholin-4-ylmethyl)phenyl]-2-..
A 77.3
/53.6
22
/22
JAK2_HUMAN Tyrosine-protein kinase JAK2
3zon[1] B IK1
5-PHENYL-2-UREIDOTHIOPHENE-3-CARBOXAMIDE[18 atoms]..
A 100.0
/100.0
13
/13
TYK2_HUMAN NON-RECEPTOR TYROSINE-PROTEIN KINASE TYK2
5ut3[1] B IK1
5-PHENYL-2-UREIDOTHIOPHENE-3-CARBOXAMIDE[18 atoms]..
A 55.6
/47.2
9
/9
JAK2_HUMAN Tyrosine-protein kinase JAK2
4p7e[3] C 2HB
N-(5-{4-[(1,1-dioxidothiomorpholin-4-yl)methyl]phe..
A 80.0
/51.6
20
/20
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut1[1] F 7DZ
(7S)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-d..
A 53.8
/47.2
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut2[1] D 3YT
2-{[(1R,2S)-2-aminocyclohexyl]amino}-4-{[3-(2H-1,2..
A 58.3
/47.2
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut6[1] B 8MY
4-({4-amino-6-[3-(hydroxymethyl)-1H-pyrazol-1-yl]p..
A 50.0
/47.2
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
5wij[3] B AQG
4-{[6-(cyclohexylmethoxy)-7H-purin-2-yl]amino}-N,N..
A 46.2
/47.2
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
5wik[1] B 584
(7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-5,7-d..
A 60.0
/47.2
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
5wil[1] B YDJ
5-(3-fluorophenyl)-N-[(3S)-3-piperidyl]-3-ureido-t..
A 61.5
/47.2
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
6brw[1] B 5BS
4-[(5,10-dimethyl-6-oxo-6,10-dihydro-5H-pyrimido[5..
A 53.3
/47.2
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
6bs0[1] B E4V
4-(5-aminopyrazin-2-yl)-1H-pyrrolo[2,3-b]pyridin-6..
A 55.6
/47.2
9
/9
JAK2_HUMAN Tyrosine-protein kinase JAK2
6m9h[1] B J9D
4-({4-amino-6-[4-(2-hydroxyethyl)-1H-imidazol-1-yl..
A 50.0
/47.2
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
6oav[1] B M3A
5-amino-3-[(4-cyanophenyl)amino]-N-phenyl-1H-1,2,4..
A 57.1
/47.2
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
6obb[1] B M3Y
5-amino-N-phenyl-3-[(4-sulfamoylphenyl)amino]-1H-1..
A 53.3
/47.2
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
6obf[1] C M4G
[4-({5-amino-3-[(4-sulfamoylphenyl)amino]-1H-1,2,4..
A 58.8
/47.2
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
6obl[1] B M4P
[4-({5-amino-3-[(4-cyanophenyl)amino]-1H-1,2,4-tri..
A 63.2
/47.2
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
7jyq[1] C VPJ
N~2~-(4-fluorophenyl)-6-{[(5-{[(oxolan-2-yl)methyl..
A 45.5
/47.2
11
/11
JAK2_HUMAN Tyrosine-protein kinase JAK2
7t0p[2] C E3W
4'-{[5-amino-3-(4-sulfamoylanilino)-1H-1,2,4-triaz..
A 63.6
/47.2
22
/22
JAK2_HUMAN Tyrosine-protein kinase JAK2
7t1t[1] B E8I
(2S)-2-[({4-[(2-amino-7H-pyrrolo[2,3-d]pyrimidin-4..
A 68.4
/47.2
19
/19
JAK2_HUMAN Tyrosine-protein kinase JAK2
8b9e[2] D Q7F
6-[[methyl-[(3-methylthiophen-2-yl)methyl]amino]me..
A 46.2
/46.8
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bak[2] G AD5
N~6~-cyclohexyl-N~2~-(4-morpholin-4-ylphenyl)-9H-p..
A 50.0
/46.8
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ex2[1] B Q2Q
3,5-diphenyl-2-(trifluoromethyl)-6~{H}-pyrazolo[1,..
A 50.0
/47.2
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
6g3c[2] C EKT
2-[[3,5-bis(fluoranyl)-4-oxidanyl-phenyl]amino]-5,..
A 55.6
/46.8
18
/18
Q506Q0_HUMAN Tyrosine-protein kinase
6xjk[1] B V4D
4-({4-amino-6-[(1H-indol-5-yl)oxy]-1,3,5-triazin-2..
A 46.7
/47.1
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usy[3] C SKE
4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,..
A 81.8
/53.8
11
/11
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usz[3] B SKE
4-({5-amino-1-[(2,6-difluorophenyl)carbonyl]-1H-1,..
A 53.3
/47.2
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut0[4] D 35R
1-cyclopropyl-3-{3-[5-(morpholin-4-ylmethyl)-1H-be..
A 50.0
/47.2
10
/10
JAK2_HUMAN Tyrosine-protein kinase JAK2
7f7w[2] C 36H
2-((1-(2-fluoro-4-((4-(1-isopropyl-1H-pyrazol-4-yl..
A 50.0
/46.8
16
/16
JAK2_HUMAN Tyrosine-protein kinase JAK2
8b8u[4] D T7I
3,5-diphenyl-2-(trifluoromethyl)-1~{H}-pyrazolo[1,..
A 42.9
/46.8
14
/14
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ba2[1] H Q9X
6-[[(5-bromanylthiophen-2-yl)methyl-methyl-amino]m..
A 46.2
/46.8
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ba3[2] B Q8U
1-(3,4-diazatricyclo[9.4.0.0^{2,7}]pentadeca-1(11)..
A 70.6
/47.2
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bab[1] I Q8N
6-[(1-methylimidazol-2-yl)sulfanylmethyl]-~{N}4-(3..
A 46.2
/46.8
13
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
4fvq[4] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 66.7
/47.2
18
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
5i4n[1] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 64.7
/46.5
17
/17
JAK2_HUMAN Tyrosine-protein kinase JAK2
4ymj[1] H 4EJ
4-[6-(benzylamino)imidazo[1,2-b]pyridazin-3-yl]ben..
B 76.9
/45.9
13
/13
NTRK3_HUMAN NT-3 growth factor receptor
1u4d[1] E DBQ
DEBROMOHYMENIALDISINE[18 atoms]
B 69.2
/43.0
13
/13
ACK1_HUMAN Activated CDC42 kinase 1
6vqm[2] C R7P
2-({4-[(3R,5S)-3,5-dimethylpiperazin-1-yl]-2-metho..
A 68.8
/42.4
16
/16
ACK1_HUMAN Activated CDC42 kinase 1
7kp6[2] C WTP
5-chloro-N~2~-[4-(4-methylpiperazin-1-yl)phenyl]-N..
A 71.4
/42.4
14
/14
ACK1_HUMAN Activated CDC42 kinase 1
4id7[2] B 1G0
cis-3-[8-amino-1-(4-phenoxyphenyl)imidazo[1,5-a]py..
A 64.7
/42.6
17
/17
ACK1_HUMAN Activated CDC42 kinase 1
4at5[1] B MUJ
5-{3-methoxy-4-[(4-methoxybenzyl)oxy]benzyl}pyrimi..
A 75.0
/42.6
16
/16
NTRK2_HUMAN BDNF/NT-3 GROWTH FACTORS RECEPTOR
3eqr[3] C T74
N~3~-(2,6-dimethylphenyl)-1-(3-methoxy-3-methylbut..
A 70.0
/42.6
20
/20
ACK1_HUMAN Activated CDC42 kinase 1
3eqp[3] C T95
N-(2,6-dimethylphenyl)-4-(2-ethoxyphenoxy)-2-({4-[..
A 80.0
/42.4
20
/20
ACK1_HUMAN Activated CDC42 kinase 1
4ewh[2] C T77
6-{4-[2-(dimethylamino)ethoxy]phenyl}-N-(1,3-dithi..
A 80.0
/42.1
15
/15
ACK1_HUMAN Activated CDC42 kinase 1
8hmt[2] E LWX
6-(2-bromophenyl)-2-[[3-methyl-4-(4-methylpiperazi..
A 76.5
/42.1
17
/17
ACK1_HUMAN Activated CDC42 kinase 1
8fe9[1] B R9B
N-[(1S)-1-benzyl-2-[(6-chloro-2-oxo-1H-quinolin-4-..
A 78.6
/42.0
14
/14
ACK1_HUMAN Activated CDC42 kinase 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1187 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7ax4[2] D CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3jy9[1] C NA
SODIUM ION[1 atoms]
A 0.0
/53.4
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
6elr[1] E NA
SODIUM ION[1 atoms]
B 33.3
/61.3
3
/3
JAK1_HUMAN Tyrosine-Protein Kinase JAK1
1u4d[1] D CL
CHLORIDE ION[1 atoms]
B 20.0
/43.0
5
/5
ACK1_HUMAN Activated CDC42 kinase 1
3eqp[2] D CL
CHLORIDE ION[1 atoms]
A 33.3
/42.4
3
/4
ACK1_HUMAN Activated CDC42 kinase 1
3zc6[1] G CL
CHLORIDE ION[1 atoms]
A 50.0
/50.9
2
/2
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
3zc6[2] H CL
CHLORIDE ION[1 atoms]
A 0.0
/50.9
2
/2
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
3zc6[1] I CL
CHLORIDE ION[1 atoms]
A 50.0
/50.9
4
/4
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
5hez[6] E CL
CHLORIDE ION[1 atoms]
A 0.0
/50.7
1
/1
JAK2_HUMAN Tyrosine-protein kinase JAK2
6nzp[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
1
/1
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nzp[1] E CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
7kp6[1] D CL
CHLORIDE ION[1 atoms]
A 25.0
/42.4
4
/5
ACK1_HUMAN Activated CDC42 kinase 1
7kp6[1] E CL
CHLORIDE ION[1 atoms]
A 40.0
/42.4
5
/5
ACK1_HUMAN Activated CDC42 kinase 1
7uyv[1] I CL
CHLORIDE ION[1 atoms]
D 0.0
/51.9
2
/2
JAK3_HUMAN Tyrosine-protein kinase JAK3
5hez[8] F ZN
ZINC ION[1 atoms]
A 50.0
/50.7
2
/2
JAK2_HUMAN Tyrosine-protein kinase JAK2
4fvq[4] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/47.2
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
4gvj[2] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/97.9
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c03[2] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5i4n[1] C MG
MAGNESIUM ION[1 atoms]
A 100.0
/46.5
1
/1
JAK2_HUMAN Tyrosine-protein kinase JAK2
5khw[2] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/61.4
2
/2
JAK1_HUMAN Tyrosine-protein kinase JAK1
6c7y[2] D MG
MAGNESIUM ION[1 atoms]
A 100.0
/61.5
2
/2
JAK1_HUMAN Tyrosine-protein kinase JAK1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1187 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4wov[2] B TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2[256 aa] A 100.0
/100.0
10
/10
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5tkd[2] B TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2[247 aa] A 100.0
/100.0
12
/12
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6nze[16] B TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2[254 aa] A 100.0
/100.0
7
/7
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4e5w[8] B JAK1_HUMAN Tyrosine-protein kinase JAK1[280 aa] A 50.0
/58.9
20
/20
JAK1_HUMAN Tyrosine-protein kinase JAK1
6aah[1] B JAK1_HUMAN Tyrosine-protein kinase JAK1[286 aa] A 50.0
/61.0
6
/6
JAK1_HUMAN Tyrosine-protein kinase JAK1
6aah[1] A JAK1_HUMAN Tyrosine-protein kinase JAK1[285 aa] B 14.3
/60.8
7
/7
JAK1_HUMAN Tyrosine-protein kinase JAK1
4l00[4] B JAK1_HUMAN Tyrosine-protein kinase JAK1[278 aa] A 57.9
/56.7
19
/23
JAK1_HUMAN Tyrosine-protein kinase JAK1
5hez[8] B JAK2_HUMAN Tyrosine-protein kinase JAK2[291 aa] A 31.2
/50.7
16
/18
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] B JAK2_HUMAN Tyrosine-protein kinase JAK2[291 aa] A 28.6
/50.7
7
/7
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] C JAK2_HUMAN Tyrosine-protein kinase JAK2[291 aa] A 66.7
/50.7
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
5hez[8] D JAK2_HUMAN Tyrosine-protein kinase JAK2[291 aa] A 33.3
/50.7
12
/12
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g6z[2] B JAK2_HUMAN Tyrosine-protein kinase JAK2[280 aa] A 0.0
/53.8
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g8o[4] B JAK2_HUMAN Tyrosine-protein kinase JAK2[279 aa] A 27.3
/53.6
11
/13
JAK2_HUMAN Tyrosine-protein kinase JAK2
6aak[2] B JAK3_HUMAN Tyrosine-protein kinase JAK3[285 aa] A 9.1
/51.3
11
/11
JAK3_HUMAN Tyrosine-protein kinase JAK3
6aak[2] A JAK3_HUMAN Tyrosine-protein kinase JAK3[277 aa] B 0.0
/50.9
10
/10
JAK3_HUMAN Tyrosine-protein kinase JAK3
7t6f[4] D B1ASP2_MOUSE Tyrosine-protein kinase[1045 aa] A 66.7
/51.5
12
/12
B1ASP2_MOUSE Tyrosine-protein kinase
8c08[2] B JAK2_HUMAN Tyrosine-protein kinase JAK2[269 aa] A 40.0
/46.4
15
/15
JAK2_HUMAN Tyrosine-protein kinase JAK2
3eqp[6] B ACK1_HUMAN Activated CDC42 kinase 1[268 aa] A 0.0
/42.4
7
/11
ACK1_HUMAN Activated CDC42 kinase 1
4ewh[1] B ACK1_HUMAN Activated CDC42 kinase 1[275 aa] A 0.0
/42.1
3
/3
ACK1_HUMAN Activated CDC42 kinase 1
4ewh[1] A ACK1_HUMAN Activated CDC42 kinase 1[274 aa] B 0.0
/42.1
3
/3
ACK1_HUMAN Activated CDC42 kinase 1
6vqm[2] B ACK1_HUMAN Activated CDC42 kinase 1[267 aa] A 0.0
/42.4
10
/16
ACK1_HUMAN Activated CDC42 kinase 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1187 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4aqc[2] D SO4
SULFATE ION[5 atoms]
A 33.3
/51.0
3
/3
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4aqc[10] G SO4
SULFATE ION[5 atoms]
B 66.7
/51.4
3
/3
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4aqc[1] H SO4
SULFATE ION[5 atoms]
B 40.0
/51.4
5
/5
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4aqc[1] I SO4
SULFATE ION[5 atoms]
B 50.0
/51.4
2
/2
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4gfo[1] B SO4
SULFATE ION[5 atoms]
A 100.0
/98.9
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4id7[2] C SO4
SULFATE ION[5 atoms]
A 28.6
/42.6
7
/7
ACK1_HUMAN Activated CDC42 kinase 1
4wov[4] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4wov[2] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
7
/7
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4wov[10] I SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5tkd[3] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5tkd[2] G SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5tkd[1] F SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
6
/6
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5toz[3] C SO4
SULFATE ION[5 atoms]
A 100.0
/51.8
1
/1
JAK3_HUMAN Tyrosine-protein kinase JAK3
5ttu[1] D SO4
SULFATE ION[5 atoms]
A 100.0
/51.9
5
/5
JAK3_HUMAN Tyrosine-protein kinase JAK3
5usy[2] D SO4
SULFATE ION[5 atoms]
A 50.0
/53.8
2
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usy[1] K SO4
SULFATE ION[5 atoms]
B 40.0
/53.8
5
/5
JAK2_HUMAN Tyrosine-protein kinase JAK2
6e2p[1] E SO4
SULFATE ION[5 atoms]
A 0.0
/36.1
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
6nze[1] E SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
6vqm[1] E SO4
SULFATE ION[5 atoms]
B 28.6
/42.7
7
/7
ACK1_HUMAN Activated CDC42 kinase 1
7q6h[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/51.8
3
/3
JAK3_HUMAN Tyrosine-protein kinase JAK3
7uyu[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4c61[4] D ACT
ACETATE ION[3 atoms]
A 20.0
/53.9
5
/5
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4c61[2] G ACT
ACETATE ION[3 atoms]
B 66.7
/55.4
3
/3
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4fvq[3] D ACT
ACETATE ION[4 atoms]
A 100.0
/47.2
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
4fvq[1] E ACT
ACETATE ION[4 atoms]
A 66.7
/47.2
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut0[2] E ACT
ACETATE ION[4 atoms]
A 75.0
/47.2
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut5[1] G ACT
ACETATE ION[4 atoms]
A 66.7
/47.2
6
/6
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut6[1] I ACT
ACETATE ION[4 atoms]
A 50.0
/47.2
2
/2
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ba2[1] E ACT
ACETATE ION[4 atoms]
A 33.3
/46.8
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ba2[1] F ACT
ACETATE ION[4 atoms]
A 0.0
/46.8
3
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
8s99[8] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s9a[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s9a[1] V ACT
ACETATE ION[4 atoms]
C 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8s9a[1] W ACT
ACETATE ION[4 atoms]
C 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
8tb5[2] C ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4ehz[4] F EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/60.9
6
/6
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[2] G EDO
1,2-ETHANEDIOL[4 atoms]
A 42.9
/60.9
7
/7
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[23] H EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/60.9
4
/4
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[3] I EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/60.9
4
/4
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/60.9
4
/4
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[14] O EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/61.6
2
/2
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
C 85.7
/61.6
7
/7
JAK1_HUMAN Tyrosine-protein kinase JAK1
4ehz[1] T EDO
1,2-ETHANEDIOL[4 atoms]
D 25.0
/61.3
4
/5
JAK1_HUMAN Tyrosine-protein kinase JAK1
4gfo[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/98.9
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4gfo[8] E EDO
1,2-ETHANEDIOL[4 atoms]
A 83.3
/98.9
6
/6
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c01[3] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN NON-RECEPTOR TYROSINE-PROTEIN KINASE TYK2
5c01[3] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
TYK2_HUMAN NON-RECEPTOR TYROSINE-PROTEIN KINASE TYK2
5c03[2] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c03[8] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c03[17] P EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5lwm[4] E EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/50.9
3
/3
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwm[9] G EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/50.9
4
/4
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwm[6] H EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/50.9
3
/5
JAK3_HUMAN Tyrosine-protein kinase JAK3
5lwn[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 16.7
/50.9
6
/6
JAK3_HUMAN Tyrosine-protein kinase JAK3
6c7y[2] G EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/61.5
3
/3
JAK1_HUMAN Tyrosine-protein kinase JAK1
6c7y[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/61.5
1
/1
JAK1_HUMAN Tyrosine-protein kinase JAK1
6g3c[2] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/46.8
2
/2
Q506Q0_HUMAN Tyrosine-protein kinase
6g3c[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/46.8
1
/1
Q506Q0_HUMAN Tyrosine-protein kinase
6gl9[3] J EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/51.1
6
/6
JAK3_HUMAN Tyrosine-protein kinase JAK3
6gl9[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/51.1
2
/2
JAK3_HUMAN Tyrosine-protein kinase JAK3
6gla[2] G EDO
1,2-ETHANEDIOL[4 atoms]
A 88.9
/50.9
9
/9
JAK3_HUMAN Tyrosine-protein kinase JAK3
6gla[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/50.9
3
/3
JAK3_HUMAN Tyrosine-protein kinase JAK3
6wtn[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/51.1
2
/2
JAK2_HUMAN Tyrosine-protein kinase JAK2
6wto[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/54.3
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
7apf[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/50.9
2
/2
JAK3_HUMAN Tyrosine-protein kinase JAK3
7apf[1] M EDO
1,2-ETHANEDIOL[4 atoms]
B 50.0
/51.4
6
/6
JAK3_HUMAN Tyrosine-protein kinase JAK3
7apg[1] U EDO
1,2-ETHANEDIOL[4 atoms]
C 33.3
/51.6
3
/3
JAK3_HUMAN Tyrosine-protein kinase JAK3
8g6z[1] E EDO
1,2-ETHANEDIOL[4 atoms]
B 66.7
/53.8
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g8o[1] F EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/52.9
7
/7
JAK2_HUMAN Tyrosine-protein kinase JAK2
8s9a[1] X EDO
1,2-ETHANEDIOL[4 atoms]
C 100.0
/100.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5c01[2] C UNL
UNKNOWN LIGAND[30 atoms]
A 100.0
/100.0
15
/15
TYK2_HUMAN NON-RECEPTOR TYROSINE-PROTEIN KINASE TYK2
3nyx[1] C DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 100.0
/99.0
2
/2
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3nyx[1] D DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 100.0
/99.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
3zc6[2] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 66.7
/50.9
3
/3
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
4e5w[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/58.9
2
/2
JAK1_HUMAN Tyrosine-protein kinase JAK1
5e1e[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 25.0
/61.6
4
/4
JAK1_HUMAN Tyrosine-protein kinase JAK1
3zmm[2] D ACE
ACETYL GROUP[3 atoms]
A 25.0
/53.7
4
/4
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
3zmm[1] G ACE
ACETYL GROUP[3 atoms]
B 66.7
/55.4
3
/3
JAK2_HUMAN TYROSINE-PROTEIN KINASE JAK2
4gl9[1] O PO4
PHOSPHATE ION[5 atoms]
B 0.0
/54.0
2
/2
G5E852_MOUSE Tyrosine-protein kinase
6wtq[1] C TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 33.3
/53.7
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usz[5] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 33.3
/47.2
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
6m9h[1] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 0.0
/47.2
1
/1
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bx9[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/51.0
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
8g8o[1] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 0.0
/53.6
2
/2
JAK2_HUMAN Tyrosine-protein kinase JAK2
3zc6[2] K PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 0.0
/51.5
5
/5
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
3ugc[1] C MLI
MALONATE ION[7 atoms]
A 0.0
/53.8
2
/2
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bxc[1] D MLI
MALONATE ION[7 atoms]
B 16.7
/53.5
6
/6
JAK2_HUMAN Tyrosine-protein kinase JAK2
8bxh[1] C MLI
MALONATE ION[7 atoms]
A 33.3
/51.0
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
3zep[8] H GOL
GLYCEROL[6 atoms]
C 0.0
/51.1
2
/2
JAK3_HUMAN TYROSINE-PROTEIN KINASE JAK3
4at5[3] C GOL
GLYCEROL[6 atoms]
A 0.0
/42.6
6
/7
NTRK2_HUMAN BDNF/NT-3 GROWTH FACTORS RECEPTOR
4e6d[1] E GOL
GLYCEROL[6 atoms]
B 85.7
/51.6
7
/7
JAK2_HUMAN Tyrosine-protein kinase JAK2
4fvp[14] B GOL
GLYCEROL[6 atoms]
A 57.1
/47.2
7
/7
JAK2_HUMAN Tyrosine-protein kinase JAK2
4fvp[34] C GOL
GLYCEROL[6 atoms]
A 100.0
/47.2
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
4gfo[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/98.9
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4po6[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4po6[1] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4po6[5] E GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
4ymj[1] I GOL
GLYCEROL[6 atoms]
B 80.0
/45.9
5
/5
NTRK3_HUMAN NT-3 growth factor receptor
4ymj[1] J GOL
GLYCEROL[6 atoms]
B 50.0
/45.9
6
/6
NTRK3_HUMAN NT-3 growth factor receptor
5c01[5] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
2
/2
TYK2_HUMAN NON-RECEPTOR TYROSINE-PROTEIN KINASE TYK2
5c03[1] M GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
3
/3
TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2
5i4n[1] D GOL
GLYCEROL[6 atoms]
A 60.0
/46.5
5
/5
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usy[1] G GOL
GLYCEROL[6 atoms]
A 33.3
/53.8
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
5usz[20] D GOL
GLYCEROL[6 atoms]
A 66.7
/47.2
3
/3
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut1[3] D GOL
GLYCEROL[6 atoms]
A 66.7
/47.2
6
/6
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut6[4] E GOL
GLYCEROL[6 atoms]
A 66.7
/47.2
6
/6
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ut6[1] F GOL
GLYCEROL[6 atoms]
A 40.0
/47.2
5
/5
JAK2_HUMAN Tyrosine-protein kinase JAK2
6gl9[2] E GOL
GLYCEROL[6 atoms]
A 72.7
/51.1
11
/11
JAK3_HUMAN Tyrosine-protein kinase JAK3
6n77[3] D GOL
GLYCEROL[6 atoms]
B 75.0
/62.0
4
/4
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n78[5] C GOL
GLYCEROL[6 atoms]
A 100.0
/61.9
3
/3
JAK1_HUMAN Tyrosine-protein kinase JAK1
6n7a[1] C GOL
GLYCEROL[6 atoms]
A 50.0
/62.3
6
/6
JAK1_HUMAN Tyrosine-protein kinase JAK1
6wtp[1] C GOL
GLYCEROL[6 atoms]
A 25.0
/52.2
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
7q7l[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/52.8
5
/5
JAK2_HUMAN Tyrosine-protein kinase JAK2
7teu[1] C GOL
GLYCEROL[6 atoms]
A 100.0
/53.8
6
/6
JAK2_HUMAN Tyrosine-protein kinase JAK2
8ba2[2] G GOL
GLYCEROL[6 atoms]
A 25.0
/46.8
4
/4
JAK2_HUMAN Tyrosine-protein kinase JAK2
5ixd[1] C CIT
CITRIC ACID[13 atoms]
A 50.0
/47.2
6
/6
JAK1_HUMAN Tyrosine-protein kinase JAK1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.