Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4039341 233 415 P26715(NKG2A_HUMAN) RecName: Full=NKG2-A/NKG2-B type II integral membrane protein;AltName: Full=CD159 antigen-like family member A;AltName: Full=NK cell receptor A;AltName: Full=NKG2-A/B-activating NK receptor;AltName: CD_antigen=CD159a;
QUERYSEQ
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSK
NSSLLSIDNEEEMKFLSIISPSSWIGVFRNSSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P26715(NKG2A_HUMAN)]

233
region name description
1-233 CHAIN /note="NKG2-A/NKG2-B type II integral membrane protein" /id="PRO_0000046659"
1-70 TOPO_DOM /note="Cytoplasmic"
71-93 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
94-233 TOPO_DOM /note="Extracellular"
118-231 DOMAIN /note="C-type lectin"
1-29 REGION /note="Disordered"
1-16 COMPBIAS /note="Polar residues"
1-88 DISORDER predicted by DISOPRED

MONOMER
233
pdb_id a1 identity[%]2 description
3cdg H 100.0 NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3bdw[6] A KLRD1_HUMAN Natural killer cells antigen CD94[123 aa] B 100.0
/100.0
18
/18
NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein
3cdg[4] A HLAE_HUMAN HLA class I histocompatibility antigen, alpha chai.. C 0.0
/37.3
4
/13
KLRD1_HUMAN Natural killer cells antigen CD94
3cdg[4] A HLAE_HUMAN HLA class I histocompatibility antigen, alpha chai.. D 100.0
/100.0
10
/10
NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein
3cdg[4] I HLAG_HUMAN leader peptide of HLA class I histocompatibility a.. C 0.0
/37.3
2
/4
KLRD1_HUMAN Natural killer cells antigen CD94
3cdg[4] I HLAG_HUMAN leader peptide of HLA class I histocompatibility a.. D 100.0
/100.0
1
/1
NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein
8umo[2] A HA15_MOUSE H-2 class I histocompatibility antigen, D-37 alpha.. C 0.0
/31.6
5
/11
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem..
8umo[2] E HA1L_MOUSE Qdm peptide[9 aa] C 0.0
/31.6
2
/3
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem..
8umo[1] C E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem.. D 61.5
/46.4
13
/13
Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, memb..
4ezm[13] A IGHE_HUMAN Ig epsilon chain C region[211 aa] G 16.7
/40.3
6
/16
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4ezm[1] E IGHE_HUMAN Ig epsilon chain C region[191 aa] K 16.7
/40.3
6
/15
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gko[1] D IGHE_HUMAN Ig epsilon chain C region[189 aa] J 14.3
/40.3
7
/17
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gko[1] E IGHE_HUMAN Ig epsilon chain C region[180 aa] K 0.0
/40.3
5
/15
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
5lgk[2] A IGHE_HUMAN Ig epsilon chain C region[307 aa] E 20.0
/37.5
10
/22
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
3bdw[6] B NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein[11.. A 35.3
/37.3
17
/17
KLRD1_HUMAN Natural killer cells antigen CD94
1umr[20] C CVXB_CRODU CONVULXIN BETA[125 aa] A 30.0
/36.5
10
/41
CVXA_CRODU CONVULXIN ALPHA
1umr[20] C CVXB_CRODU CONVULXIN BETA[125 aa] A 20.0
/36.5
5
/8
CVXA_CRODU CONVULXIN ALPHA
1qo3[4] A HA12_MOUSE MHC CLASS I H-2DD HEAVY CHAIN[274 aa] C 33.3
/35.8
6
/6
LY4A_MOUSE LY49A
4pp8[2] C RAE1B_MOUSE Retinoic acid early-inducible protein 1-beta[146 a.. A 0.0
/35.4
2
/8
NKG2D_MOUSE NKG2-D type II integral membrane protein
4pp8[1] D RAE1B_MOUSE Retinoic acid early-inducible protein 1-beta[150 a.. A 0.0
/35.4
2
/3
NKG2D_MOUSE NKG2-D type II integral membrane protein
7odu[1] C KRBBA_RAT Killer cell lectin-like receptor subfamily B membe.. A 50.0
/35.0
2
/20
CL2DB_RAT C-type lectin domain family 2 member D11
3ubu[1] A AGGA1_AGKAC Agglucetin subunit alpha-1[130 aa] B 22.2
/34.5
36
/38
AGGB2_AGKAC Agglucetin subunit beta-2
6xfq[1] B SLA1_DEIAC Snaclec agglucetin subunit alpha-1[130 aa] C 26.3
/34.5
38
/40
SLB2_DEIAC Snaclec agglucetin subunit beta-2
6xfq[1] A GP1BA_HUMAN Platelet glycoprotein Ib alpha chain[273 aa] C 11.1
/34.5
9
/14
SLB2_DEIAC Snaclec agglucetin subunit beta-2
7r8u[1] C Antigen binding fragment, Vh and Ch1[225 aa] A 66.7
/34.2
3
/19
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
7r8u[2] D Antibody light chain, kappa[216 aa] A 100.0
/34.2
1
/2
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
6a7t[2] A A0A2Z6G7U6_9BIVA N-acetylglucosamine-specific lectin[137 aa] B 0.0
/34.2
5
/9
A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin
1hyr[12] C Q9TQ92_HUMAN MHC CLASS I CHAIN-RELATED PROTEIN A[275 aa] A 0.0
/33.8
3
/12
NKG2D_HUMAN NKG2-D TYPE II INTEGRAL MEMBRANE PROTEIN
1kcg[2] C N2DL3_HUMAN ULBP3 protein[170 aa] A 0.0
/33.8
2
/11
NKG2D_HUMAN NKG2-D type II integral membrane protein
4pdc[4] E Q8QN43_COWPX CPXV018 protein[150 aa] A 0.0
/33.8
5
/12
NKG2D_HUMAN NKG2-D type II integral membrane protein
4s0u[2] C RET1L_HUMAN Retinoic acid early transcript 1L protein[175 aa] A 0.0
/33.8
3
/10
NKG2D_HUMAN NKG2-D type II integral membrane protein
1sb2[2] B RHCB_AGKRH Rhodocetin beta subunit[124 aa] A 30.8
/32.8
13
/36
RHCA_AGKRH Rhodocetin alpha subunit
6e7d[8] Q KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe.. A 0.0
/39.0
4
/19
CLC2D_MOUSE C-type lectin domain family 2 member D
1umr[20] A CVXA_CRODU CONVULXIN ALPHA[135 aa] C 20.0
/32.1
35
/35
CVXB_CRODU CONVULXIN BETA
1umr[20] A CVXA_CRODU CONVULXIN ALPHA[135 aa] C 33.3
/32.1
6
/11
CVXB_CRODU CONVULXIN BETA
1umr[8] B CVXA_CRODU CONVULXIN ALPHA[135 aa] C 0.0
/32.1
3
/6
CVXB_CRODU CONVULXIN BETA
3j82[1] B ACTB_HUMAN Actin, cytoplasmic 1[374 aa] A 0.0
/31.6
6
/6
CLC9A_MOUSE C-type lectin domain family 9 member A
3j82[1] D ACTB_HUMAN Actin, cytoplasmic 1[374 aa] A 16.7
/31.6
6
/7
CLC9A_MOUSE C-type lectin domain family 9 member A
8umo[1] D Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, memb.. C 28.6
/31.6
14
/14
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem..
6e7d[8] A CLC2D_MOUSE C-type lectin domain family 2 member D[121 aa] Q 20.0
/32.1
15
/17
KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe..
6e7d[8] P CLC2D_MOUSE C-type lectin domain family 2 member D[122 aa] Q 20.0
/32.1
5
/5
KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe..
5tzn[2] B D3XDJ6_MUHV1 Glycoprotein family protein m12[137 aa] A 30.4
/31.0
23
/27
KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe..
1p4l[3] A HA1B_MOUSE MHC CLASS I H-2KB HEAVY CHAIN[273 aa] D 15.8
/30.5
19
/19
KLRA3_MOUSE LY49-C
7odu[1] A CL2DB_RAT C-type lectin domain family 2 member D11[129 aa] C 26.3
/30.4
19
/19
KRBBA_RAT Killer cell lectin-like receptor subfamily B membe..
6a7t[2] B A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin[138 aa] A 0.0
/30.0
2
/6
A0A2Z6G7U6_9BIVA N-acetylglucosamine-specific lectin
1p1z[2] A HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha .. D 10.5
/29.5
19
/19
KLRA3_MOUSE LY49-C antigen
1p1z[5] B B2MG_MOUSE Beta-2-microglobulin[97 aa] D 37.5
/29.5
8
/8
KLRA3_MOUSE LY49-C antigen
1qo3[2] B B2MG_MOUSE BETA-2-MICROGLOBULIN[100 aa] C 0.0
/35.8
2
/2
LY4A_MOUSE LY49A
1qo3[2] B B2MG_MOUSE BETA-2-MICROGLOBULIN[100 aa] D 40.0
/35.8
10
/11
LY4A_MOUSE LY49A
5j6g[2] B B2MG_MOUSE Beta-2-microglobulin[99 aa] G 37.5
/29.5
8
/8
KLRA3_MOUSE Killer cell lectin-like receptor 3
5j6g[2] A HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha .. G 11.8
/29.5
17
/17
KLRA3_MOUSE Killer cell lectin-like receptor 3
3wsr[1] C PDPN_HUMAN Peptide from Podoplanin[10 aa] A 0.0
/28.1
8
/8
CLC1B_HUMAN C-type lectin domain family 1 member B
3wsr[1] D PDPN_HUMAN Peptide from Podoplanin[11 aa] B 0.0
/28.1
8
/8
CLC1B_HUMAN C-type lectin domain family 1 member B
3wwk[4] B SLYA_CALRH Snaclec rhodocytin subunit alpha[133 aa] A 0.0
/28.1
8
/8
CLC1B_HUMAN C-type lectin domain family 1 member B
4iop[1] A CLC2A_HUMAN C-type lectin domain family 2 member A[117 aa] B 27.8
/28.0
18
/22
KLRF2_HUMAN Killer cell lectin-like receptor subfamily F membe..
3ff7[4] A CADH1_HUMAN Epithelial cadherin[97 aa] C 0.0
/33.9
12
/12
KLRG1_HUMAN Killer cell lectin-like receptor subfamily G membe..
3ff7[2] B CADH1_HUMAN Epithelial cadherin[98 aa] C 22.2
/33.9
9
/9
KLRG1_HUMAN Killer cell lectin-like receptor subfamily G membe..
4iop[1] B KLRF2_HUMAN Killer cell lectin-like receptor subfamily F membe.. A 12.5
/26.9
16
/17
CLC2A_HUMAN C-type lectin domain family 2 member A
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8ea5[2] C VN8
(3S,5aS,8aR)-3-benzyl-6-[(3,5-dichlorophenyl)methy..
A 16.7
/36.1
6
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea9[2] D VMQ
N-[(1S)-1-[3,5-bis(trifluoromethyl)phenyl]-2-(dime..
A 14.3
/35.6
7
/7
NKG2D_HUMAN NKG2-D type II integral membrane protein
8se5[2] H ZW7
N-{(1S)-2-[(1R,5S,6S)-6-(hydroxymethyl)-3-azabicyc..
A 16.7
/36.6
6
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea7[2] D VMH
(4M)-N-{(1S)-2-(dimethylamino)-2-oxo-1-[3-(trifluo..
A 16.7
/36.1
6
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8eaa[2] C VMW
N-{(1S)-2-(dimethylamino)-1-[3-methyl-5-(trifluoro..
A 14.3
/35.1
7
/7
NKG2D_HUMAN NKG2-D type II integral membrane protein
8se6[2] F ZWA
N-[(1S)-2-(dimethylamino)-2-oxo-1-{3-[3-(2,2,2-tri..
A 16.7
/35.6
6
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea8[2] F VML
N-{(1S)-2-(dimethylamino)-2-oxo-1-[3-(trifluoromet..
A 16.7
/34.2
6
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8eab[2] D VN2
N-[(1S)-2-oxo-1-[3-(trifluoromethyl)phenyl]-2-({4-..
A 22.2
/36.6
9
/10
NKG2D_HUMAN NKG2-D type II integral membrane protein
6tl9[8] J NJT
9-chloranyl-5-propyl-11~{H}-pyrido[2,3-b][1,4]benz..
B 50.0
/34.2
2
/5
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
8ea6[2] C VMB
N-{(1S)-2-(dimethylamino)-2-oxo-1-[3-(trifluoromet..
A 14.3
/33.8
7
/7
NKG2D_HUMAN NKG2-D type II integral membrane protein
5m62[3] K BGC
beta-D-glucopyranose[12 atoms]
A 0.0
/31.5
3
/6
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[3] O GLC
alpha-D-glucopyranose[12 atoms]
B 0.0
/31.5
3
/6
CLC4K_MOUSE C-type lectin domain family 4 member K
4qkg[10] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/33.0
5
/5
CLC2D_HUMAN C-type lectin domain family 2 member D
4qkh[15] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 20.0
/30.6
5
/5
CLC2D_HUMAN C-type lectin domain family 2 member D
6m5m[1] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms]..
A 0.0
/30.0
1
/9
A0A2Z6G7U6_9BIVA N-acetylglucosamine-specific lectin
7odu[2] I NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 0.0
/30.4
1
/2
KRBBA_RAT Killer cell lectin-like receptor subfamily B membe..
6pws[1] D MMA
methyl alpha-D-mannopyranoside[13 atoms]
A 40.0
/30.0
5
/5
E1BIQ4_BOVIN Fc fragment of IgE receptor II
6py1[4] B A2G
2-acetamido-2-deoxy-alpha-D-galactopyranose[15 ato..
A 0.0
/29.3
1
/10
CLC10_HUMAN C-type lectin domain family 10 member A
6xiy[2] B Q3M
Methyl 2-(acetylamino)-2-deoxy-1-thio-alpha-D-gala..
A 0.0
/29.3
1
/10
CLC10_HUMAN C-type lectin domain family 10 member A
8hb5[1] E L6N
(2~{R},3~{R},4~{S},5~{S},6~{R})-6-(methoxymethyl)o..
A 100.0
/29.0
2
/8
E1BHM0_BOVIN C-type lectin domain family 4 member E
6ghv[6] G EZ8
[1-[(2~{S},3~{S},4~{R},5~{S},6~{R})-2-[(1~{S},2~{S..
A 0.0
/28.7
9
/13
CD209_HUMAN CD209 antigen
7nl6[1] E UH8
Methyl 2-deoxy-2-(4-(pyridine-3-yl))-1,2,3-triazol..
A 0.0
/28.7
5
/7
CD209_HUMAN DC-SIGN, CRD domain
7nl7[1] E UH5
3-Aminopropyl 2-deoxy-2-(4-phenyl-1,2,3-triazol-1-..
A 0.0
/28.7
6
/9
CD209_HUMAN DC-SIGN, CRD domain
2xr5[1] B MAN
alpha-D-mannopyranose[12 atoms]
A 0.0
/28.6
4
/7
CD209_HUMAN CD209 ANTIGEN
2xr6[1] B MAN
alpha-D-mannopyranose[12 atoms]
A 0.0
/28.6
4
/7
CD209_HUMAN CD209 ANTIGEN
4caj[2] U SIA
N-acetyl-alpha-neuraminic acid[21 atoms]
B 0.0
/24.1
1
/4
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[2] V GQ1
4-O-sulfo-alpha-D-glucopyranose[16 atoms]
D 20.0
/23.7
5
/5
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[1] W GQ1
4-O-sulfo-alpha-D-glucopyranose[16 atoms]
D 0.0
/23.7
2
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8umo[1] F BR
BROMIDE ION[1 atoms]
D 50.0
/46.4
4
/4
Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, memb..
1sl5[1] E MG
MAGNESIUM ION[1 atoms]
A 0.0
/28.7
2
/2
mDC-SIGN1B type I isoform
2bph[2] C MG
MAGNESIUM ION[1 atoms]
A 66.7
/36.8
3
/4
Q6QLQ4_MOUSE DECTIN-1
1e87[5] B ZN
ZINC ION[1 atoms]
A 0.0
/31.1
1
/1
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
2ox8[4] E ZN
ZINC ION[1 atoms]
A 0.0
/29.3
1
/1
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2ox8[4] F ZN
ZINC ION[1 atoms]
A 66.7
/29.3
3
/4
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2ox8[2] G ZN
ZINC ION[1 atoms]
A 0.0
/29.3
2
/3
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2ox8[2] H ZN
ZINC ION[1 atoms]
A 0.0
/29.3
2
/4
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2ox8[2] I ZN
ZINC ION[1 atoms]
A 0.0
/29.3
3
/3
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
4wco[1] F ZN
ZINC ION[1 atoms]
B 0.0
/31.1
2
/2
CLC2D_HUMAN C-type lectin domain family 2 member D
4wco[2] G ZN
ZINC ION[1 atoms]
B 0.0
/31.1
1
/1
CLC2D_HUMAN C-type lectin domain family 2 member D
4wco[1] K ZN
ZINC ION[1 atoms]
C 0.0
/30.6
1
/1
CLC2D_HUMAN C-type lectin domain family 2 member D
4wco[1] L ZN
ZINC ION[1 atoms]
C 0.0
/30.6
1
/1
CLC2D_HUMAN C-type lectin domain family 2 member D
6w12[2] M ZN
ZINC ION[1 atoms]
A 0.0
/29.3
1
/1
CLC10_HUMAN C-type lectin domain family 10 member A
5tzn[2] K IOD
IODIDE ION[1 atoms]
A 100.0
/31.0
1
/2
KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe..
2bpe[9] D CL
CHLORIDE ION[1 atoms]
A 25.0
/36.8
4
/4
Q6QLQ4_MOUSE DECTIN-1
2bpe[4] E CL
CHLORIDE ION[1 atoms]
A 100.0
/36.8
2
/4
Q6QLQ4_MOUSE DECTIN-1
2ox8[6] J CL
CHLORIDE ION[1 atoms]
A 0.0
/29.3
1
/1
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2ox8[22] L CL
CHLORIDE ION[1 atoms]
A 25.0
/29.3
4
/5
Q9BYH7_HUMAN Scavenger receptor with C-type lectin type I
2xr6[1] I CL
CHLORIDE ION[1 atoms]
A 40.0
/28.6
5
/5
CD209_HUMAN CD209 ANTIGEN
2xr6[1] K CL
CHLORIDE ION[1 atoms]
A 0.0
/28.6
2
/2
CD209_HUMAN CD209 ANTIGEN
3rs1[1] C CL
CHLORIDE ION[1 atoms]
A 0.0
/37.5
1
/4
CLC2I_MOUSE C-type lectin domain family 2 member I
4caj[1] J CL
CHLORIDE ION[1 atoms]
A 33.3
/24.1
3
/3
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
6ghv[2] L CL
CHLORIDE ION[1 atoms]
A 0.0
/28.7
2
/2
CD209_HUMAN CD209 antigen
6w12[4] J CL
CHLORIDE ION[1 atoms]
A 50.0
/29.3
2
/5
CLC10_HUMAN C-type lectin domain family 10 member A
6xiy[2] J CL
CHLORIDE ION[1 atoms]
A 0.0
/29.3
2
/2
CLC10_HUMAN C-type lectin domain family 10 member A
1xar[4] C NA
SODIUM ION[1 atoms]
A 100.0
/30.1
1
/4
209L1_HUMAN CD209 antigen-like protein 1
3hup[1] H NA
SODIUM ION[1 atoms]
A 50.0
/30.9
2
/2
CD69_HUMAN Early activation antigen CD69
3hup[1] H NA
SODIUM ION[1 atoms]
B 66.7
/31.1
3
/3
CD69_HUMAN Early activation antigen CD69
4kzv[1] F NA
SODIUM ION[1 atoms]
A 100.0
/29.2
1
/4
E1BHM0_BOVIN C-type lectin mincle
4kzw[1] F NA
SODIUM ION[1 atoms]
A 0.0
/29.2
1
/4
E1BHM0_BOVIN C-TYPE LECTIN MINCLE
1dv8[1] B CA
CALCIUM ION[1 atoms]
A 0.0
/26.6
1
/4
ASGR1_HUMAN ASIALOGLYCOPROTEIN RECEPTOR 1
1dv8[158] D CA
CALCIUM ION[1 atoms]
A 50.0
/26.6
2
/3
ASGR1_HUMAN ASIALOGLYCOPROTEIN RECEPTOR 1
2bpe[9] C CA
CALCIUM ION[1 atoms]
A 66.7
/36.8
3
/4
Q6QLQ4_MOUSE DECTIN-1
2cl8[6] D CA
CALCIUM ION[1 atoms]
A 66.7
/36.8
3
/4
Q6QLQ4_MOUSE DECTIN-1
2xr6[1] H CA
CALCIUM ION[1 atoms]
A 0.0
/28.6
3
/5
CD209_HUMAN CD209 ANTIGEN
3j82[17] E CA
CALCIUM ION[1 atoms]
A 33.3
/31.6
3
/3
CLC9A_MOUSE C-type lectin domain family 9 member A
3wh2[2] B CA
CALCIUM ION[1 atoms]
A 100.0
/28.1
2
/4
CLC4E_HUMAN C-type lectin domain family 4 member E
4zrv[3] I CA
CALCIUM ION[1 atoms]
A 0.0
/29.2
2
/5
E1BHM0_BOVIN Mincle CRD
4zrw[3] D CA
CALCIUM ION[1 atoms]
A 33.3
/29.0
3
/4
E1BHM0_BOVIN mincle protein
4zrw[3] E CA
CALCIUM ION[1 atoms]
A 0.0
/29.0
2
/5
E1BHM0_BOVIN mincle protein
5b1w[8] E CA
CALCIUM ION[1 atoms]
A 33.3
/35.4
3
/4
CLC4A_HUMAN C-type lectin domain family 4 member A
5jpv[5] E CA
CALCIUM ION[1 atoms]
A 0.0
/26.6
1
/4
ASGR1_HUMAN Asialoglycoprotein receptor 1
6a7s[4] D CA
CALCIUM ION[1 atoms]
A 33.3
/34.2
3
/4
A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin
6a7t[2] C CA
CALCIUM ION[1 atoms]
A 33.3
/30.0
3
/4
A0A2Z6G7U6_9BIVA N-acetylglucosamine-specific lectin
6py1[2] G CA
CALCIUM ION[1 atoms]
A 25.0
/29.3
4
/4
CLC10_HUMAN C-type lectin domain family 10 member A
6w12[2] E CA
CALCIUM ION[1 atoms]
A 0.0
/29.3
1
/1
CLC10_HUMAN C-type lectin domain family 10 member A
6w12[4] F CA
CALCIUM ION[1 atoms]
A 0.0
/29.3
1
/1
CLC10_HUMAN C-type lectin domain family 10 member A
6w12[4] G CA
CALCIUM ION[1 atoms]
A 0.0
/29.3
1
/4
CLC10_HUMAN C-type lectin domain family 10 member A
8h4v[3] G CA
CALCIUM ION[1 atoms]
A 33.3
/28.4
3
/4
E1BHM0_BOVIN C-type lectin domain family 4 member E
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2cl8[2] C beta-D-glucopyranose-(1-3)-beta-D-glucopyranose-(1.. A 0.0
/36.8
6
/7
Q6QLQ4_MOUSE DECTIN-1
5j2s[2] C beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 14.3
/30.7
7
/7
KRBBA_RAT Killer cell lectin-like receptor subfamily B membe..
5tzn[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 25.0
/31.0
8
/8
KRBBB_MOUSE Killer cell lectin-like receptor subfamily B membe..
7odu[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/35.0
3
/3
CL2DB_RAT C-type lectin domain family 2 member D11
7odu[2] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 12.5
/30.4
8
/8
KRBBA_RAT Killer cell lectin-like receptor subfamily B membe..
8h4v[2] C (2~{R},3~{R},4~{S},5~{S},6~{R})-6-(methoxymethyl)o.. A 100.0
/28.4
2
/6
E1BHM0_BOVIN C-type lectin domain family 4 member E
1k9i[11] K 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alp.. A 22.2
/28.6
9
/15
mDC-SIGN1B type I isoform
6pwt[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alp.. A 45.5
/30.0
11
/11
E1BIQ4_BOVIN Fc fragment of IgE receptor II
6pwr[1] B 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-2)-alp.. A 50.0
/30.0
10
/10
E1BIQ4_BOVIN Fc fragment of IgE receptor II
4kzv[1] C alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose A 100.0
/29.2
2
/9
E1BHM0_BOVIN C-type lectin mincle
4zrw[3] B alpha-D-glucopyranose-(1-1)-alpha-D-glucopyranose A 100.0
/29.0
2
/9
E1BHM0_BOVIN mincle protein
4zrv[3] D 6-O-butanoyl-alpha-D-glucopyranose-(1-1)-alpha-D-g.. A 100.0
/29.2
2
/8
E1BHM0_BOVIN Mincle CRD
1sl4[1] B alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 12.5
/28.7
8
/12
mDC-SIGN1B type I isoform
1sl5[1] B alpha-L-fucopyranose-(1-3)-[beta-D-galactopyranose.. A 0.0
/28.7
6
/10
mDC-SIGN1B type I isoform
2it5[1] B alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose-.. A 0.0
/28.7
5
/9
CD209_HUMAN CD209 antigen, DCSIGN-CRD
2it6[1] B alpha-D-mannopyranose-(1-2)-alpha-D-mannopyranose A 0.0
/28.7
7
/11
CD209_HUMAN CD209 antigen
3wsr[2] E beta-D-galactopyranose-(1-3)-[N-acetyl-alpha-neura.. A 12.5
/28.1
8
/8
CLC1B_HUMAN C-type lectin domain family 1 member B
4iop[1] C alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 50.0
/26.9
6
/6
CLC2A_HUMAN C-type lectin domain family 2 member A
4iop[1] D alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 0.0
/26.9
5
/5
CLC2A_HUMAN C-type lectin domain family 2 member A
4c9f[2] E alpha-D-glucopyranose-(1-6)-4-O-sulfo-alpha-D-gluc.. A 0.0
/24.1
7
/10
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[1] G alpha-D-glucopyranose-(1-6)-alpha-D-glucopyranose-.. C 0.0
/24.1
7
/13
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3cad[4] A Q9JHV6_MOUSE Lectin-related NK cell receptor LY49G1[123 aa] A 60.0
/41.5
10
/14
Q9JHV6_MOUSE Lectin-related NK cell receptor LY49G1
2h2r[1] A FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor (L.. B 33.3
/40.3
3
/3
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor (L..
4gi0[1] B FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor[12.. A 33.3
/40.3
3
/7
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gi0[2] C FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor[13.. A 0.0
/40.3
2
/7
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gi0[3] A FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor[13.. B 0.0
/40.3
1
/8
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
3g8k[2] B Q9JIP9_MOUSE Lectin-related NK cell receptor LY49L1[127 aa] A 55.6
/38.7
9
/11
Q9JIP9_MOUSE Lectin-related NK cell receptor LY49L1
3g8l[4] C Q9JIP9_MOUSE Lectin-related NK cell receptor LY49L1[154 aa] A 53.3
/36.8
15
/30
Q9JIP9_MOUSE Lectin-related NK cell receptor LY49L1
3rs1[2] B CLC2I_MOUSE C-type lectin domain family 2 member I[122 aa] A 27.3
/37.5
11
/18
CLC2I_MOUSE C-type lectin domain family 2 member I
6e7d[5] D CLC2D_MOUSE C-type lectin domain family 2 member D[121 aa] A 100.0
/39.0
1
/2
CLC2D_MOUSE C-type lectin domain family 2 member D
6e7d[16] E CLC2D_MOUSE C-type lectin domain family 2 member D[122 aa] A 41.7
/39.0
12
/19
CLC2D_MOUSE C-type lectin domain family 2 member D
6e7d[8] F CLC2D_MOUSE C-type lectin domain family 2 member D[122 aa] A 33.3
/39.0
6
/8
CLC2D_MOUSE C-type lectin domain family 2 member D
6e7d[8] P CLC2D_MOUSE C-type lectin domain family 2 member D[122 aa] A 0.0
/39.0
5
/11
CLC2D_MOUSE C-type lectin domain family 2 member D
6e7d[8] M CLC2D_MOUSE C-type lectin domain family 2 member D[119 aa] B 12.5
/39.0
8
/8
CLC2D_MOUSE C-type lectin domain family 2 member D
6e7d[8] N CLC2D_MOUSE C-type lectin domain family 2 member D[122 aa] B 0.0
/39.0
2
/4
CLC2D_MOUSE C-type lectin domain family 2 member D
2bpe[4] B Q6QLQ4_MOUSE DECTIN-1[129 aa] A 30.8
/36.8
13
/17
Q6QLQ4_MOUSE DECTIN-1
2bph[2] B Q6QLQ4_MOUSE DECTIN-1[129 aa] A 33.3
/36.8
12
/15
Q6QLQ4_MOUSE DECTIN-1
1umr[8] B CVXA_CRODU CONVULXIN ALPHA[135 aa] A 60.0
/36.5
5
/8
CVXA_CRODU CONVULXIN ALPHA
1qo3[4] D LY4A_MOUSE LY49A[121 aa] C 37.5
/35.8
8
/8
LY4A_MOUSE LY49A
1hq8[4] A NKG2D_MOUSE NKG2-D[123 aa] A 33.3
/35.4
18
/21
NKG2D_MOUSE NKG2-D
1hyr[40] B NKG2D_HUMAN NKG2-D TYPE II INTEGRAL MEMBRANE PROTEIN[124 aa] A 37.5
/33.8
16
/20
NKG2D_HUMAN NKG2-D TYPE II INTEGRAL MEMBRANE PROTEIN
7odu[2] B CL2DB_RAT C-type lectin domain family 2 member D11[122 aa] A 33.3
/35.0
12
/20
CL2DB_RAT C-type lectin domain family 2 member D11
1ypo[30] B P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec.. A 42.9
/34.2
14
/17
P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec..
1yxj[2] B P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec.. A 25.0
/34.2
4
/9
P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec..
6tl9[8] C OLR1_HUMAN Oxidized low-density lipoprotein receptor 1[129 aa.. A 50.0
/34.2
2
/9
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
6tla[4] B OLR1_HUMAN Oxidized low-density lipoprotein receptor 1[134 aa.. A 44.4
/34.2
18
/24
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
6a7s[2] A A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin[138 aa] A 0.0
/34.2
6
/13
A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin
1umr[8] D CVXB_CRODU CONVULXIN BETA[125 aa] C 33.3
/32.1
3
/3
CVXB_CRODU CONVULXIN BETA
5k8y[2] B CLC4K_MOUSE C-type lectin domain family 4 member K[136 aa] A 35.3
/30.6
17
/18
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[6] A CLC4K_MOUSE C-type lectin domain family 4 member K[136 aa] A 40.0
/31.5
5
/8
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[6] A CLC4K_MOUSE C-type lectin domain family 4 member K[136 aa] A 11.1
/31.5
9
/12
CLC4K_MOUSE C-type lectin domain family 4 member K
1e87[6] A CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69[117 aa] A 26.7
/31.1
15
/17
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
1fm5[1] A CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69[118 aa] A 33.3
/31.1
3
/4
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
1fm5[1] A CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69[118 aa] A 50.0
/31.1
4
/4
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
3hup[2] B CD69_HUMAN Early activation antigen CD69[118 aa] A 25.0
/30.9
20
/20
CD69_HUMAN Early activation antigen CD69
4qkh[8] B CLC2D_HUMAN C-type lectin domain family 2 member D[121 aa] A 30.0
/30.6
10
/16
CLC2D_HUMAN C-type lectin domain family 2 member D
5j2s[4] B KRBBA_RAT Killer cell lectin-like receptor subfamily B membe.. A 36.4
/30.7
11
/11
KRBBA_RAT Killer cell lectin-like receptor subfamily B membe..
1k9j[1] B mDC-SIGN2 TYPE I ISOFORM[128 aa] A 0.0
/30.3
11
/11
mDC-SIGN2 TYPE I ISOFORM
1k9j[1] A mDC-SIGN2 TYPE I ISOFORM[130 aa] B 22.2
/29.7
9
/11
mDC-SIGN2 TYPE I ISOFORM
1xar[2] A 209L1_HUMAN CD209 antigen-like protein 1[146 aa] A 0.0
/30.1
1
/1
209L1_HUMAN CD209 antigen-like protein 1
1xar[8] B 209L1_HUMAN CD209 antigen-like protein 1[144 aa] A 18.2
/30.1
11
/13
209L1_HUMAN CD209 antigen-like protein 1
1p1z[4] D KLRA3_MOUSE LY49-C antigen[118 aa] D 50.0
/29.5
4
/4
KLRA3_MOUSE LY49-C antigen
3c8j[4] B Q61198_MOUSE Natural killer cell receptor Ly49C[126 aa] A 60.0
/29.7
10
/14
Q61198_MOUSE Natural killer cell receptor Ly49C
5j6g[2] H KLRA3_MOUSE Killer cell lectin-like receptor 3[122 aa] G 66.7
/29.5
9
/12
KLRA3_MOUSE Killer cell lectin-like receptor 3
6py1[4] A CLC10_HUMAN C-type lectin domain family 10 member A[130 aa] A 0.0
/29.3
3
/9
CLC10_HUMAN C-type lectin domain family 10 member A
6w12[2] A CLC10_HUMAN C-type lectin domain family 10 member A[129 aa] A 35.7
/29.3
14
/17
CLC10_HUMAN C-type lectin domain family 10 member A
4zrv[2] B E1BHM0_BOVIN Mincle CRD[131 aa] A 20.0
/29.2
10
/12
E1BHM0_BOVIN Mincle CRD
4zrv[2] C E1BHM0_BOVIN Mincle CRD[131 aa] B 0.0
/29.2
4
/8
E1BHM0_BOVIN Mincle CRD
3m9z[6] A KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe.. A 24.2
/28.4
33
/35
KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe..
3t3a[4] B KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe.. A 21.4
/28.4
14
/15
KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe..
3t3a[2] A KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe.. B 0.0
/28.9
1
/1
KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe..
1ja3[2] B Q9JHN9_MOUSE MHC class I recognition receptor Ly49I[113 aa] A 55.6
/28.6
9
/14
Q9JHN9_MOUSE MHC class I recognition receptor Ly49I
1k9i[8] B mDC-SIGN1B type I isoform[128 aa] A 30.8
/28.6
13
/14
mDC-SIGN1B type I isoform
1k9i[9] E mDC-SIGN1B type I isoform[128 aa] B 0.0
/28.6
1
/3
mDC-SIGN1B type I isoform
1k9i[4] G mDC-SIGN1B type I isoform[128 aa] B 40.0
/28.6
5
/8
mDC-SIGN1B type I isoform
1k9i[2] H mDC-SIGN1B type I isoform[127 aa] C 12.5
/28.6
8
/8
mDC-SIGN1B type I isoform
1k9i[1] C mDC-SIGN1B type I isoform[128 aa] E 0.0
/28.6
1
/1
mDC-SIGN1B type I isoform
1k9i[1] I mDC-SIGN1B type I isoform[128 aa] E 0.0
/28.6
1
/1
mDC-SIGN1B type I isoform
1k9i[1] E mDC-SIGN1B type I isoform[128 aa] I 0.0
/28.6
2
/2
mDC-SIGN1B type I isoform
6jjj[6] B CLC4F_MOUSE C-type lectin domain family 4 member F[151 aa] A 0.0
/27.3
3
/12
CLC4F_MOUSE C-type lectin domain family 4 member F
6jjj[6] E CLC4F_MOUSE C-type lectin domain family 4 member F[151 aa] A 14.3
/27.3
7
/15
CLC4F_MOUSE C-type lectin domain family 4 member F
3ff8[2] D KLRG1_MOUSE Killer cell lectin-like receptor subfamily G membe.. C 23.1
/26.9
13
/14
KLRG1_MOUSE Killer cell lectin-like receptor subfamily G membe..
3ff9[2] B KLRG1_MOUSE Killer cell lectin-like receptor subfamily G membe.. A 18.2
/27.0
11
/11
KLRG1_MOUSE Killer cell lectin-like receptor subfamily G membe..
5jpv[4] B ASGR1_HUMAN Asialoglycoprotein receptor 1[128 aa] A 0.0
/26.6
4
/9
ASGR1_HUMAN Asialoglycoprotein receptor 1
3zhg[8] A C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B[132 aa] A 20.0
/24.1
5
/9
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[4] B C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B[133 aa] A 25.0
/24.1
16
/19
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4caj[4] B C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B[133 aa] A 26.7
/24.1
15
/17
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
233 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1yxj[4] C EDO
1,2-ETHANEDIOL[4 atoms]
A 33.3
/34.2
3
/3
P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec..
4g96[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 33.3
/40.3
3
/3
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
8ea7[10] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 40.0
/36.1
5
/5
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea7[10] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 25.0
/36.1
4
/4
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea8[1] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 50.0
/34.7
2
/3
NKG2D_HUMAN NKG2-D type II integral membrane protein
1e87[30] C GOL
GLYCEROL[6 atoms]
A 0.0
/31.1
3
/3
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
3ubu[2] D GOL
GLYCEROL[6 atoms]
B 25.0
/34.5
4
/4
AGGB2_AGKAC Agglucetin subunit beta-2
3ubu[3] E GOL
GLYCEROL[6 atoms]
B 33.3
/34.5
6
/6
AGGB2_AGKAC Agglucetin subunit beta-2
3ubu[1] F GOL
GLYCEROL[6 atoms]
B 66.7
/34.5
3
/3
AGGB2_AGKAC Agglucetin subunit beta-2
4g9a[2] G GOL
GLYCEROL[6 atoms]
B 0.0
/40.3
3
/6
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gi0[1] D GOL
GLYCEROL[6 atoms]
A 0.0
/40.3
3
/6
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gj0[1] H GOL
GLYCEROL[6 atoms]
B 0.0
/40.3
1
/3
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gk1[1] M GOL
GLYCEROL[6 atoms]
B 0.0
/40.3
1
/2
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
4gk1[3] QA GOL
GLYCEROL[6 atoms]
G 0.0
/40.3
1
/4
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
5k8y[7] H GOL
GLYCEROL[6 atoms]
B 0.0
/30.6
5
/6
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[3] F GOL
GLYCEROL[6 atoms]
A 50.0
/31.5
2
/3
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[3] H GOL
GLYCEROL[6 atoms]
A 40.0
/31.5
5
/7
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[4] I GOL
GLYCEROL[6 atoms]
A 50.0
/31.5
2
/4
CLC4K_MOUSE C-type lectin domain family 4 member K
5m62[3] I GOL
GLYCEROL[6 atoms]
A 0.0
/31.5
1
/1
CLC4K_MOUSE C-type lectin domain family 4 member K
8eaa[1] F GOL
GLYCEROL[6 atoms]
B 0.0
/35.1
1
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
2bpe[2] F PG4
TETRAETHYLENE GLYCOL[12 atoms]
A 50.0
/36.8
2
/4
Q6QLQ4_MOUSE DECTIN-1
8ea9[2] G PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 50.0
/35.6
4
/7
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea5[8] D PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/36.1
1
/7
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea8[5] C PGE
TRIETHYLENE GLYCOL[10 atoms]
A 0.0
/34.2
1
/6
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea8[2] I PGE
TRIETHYLENE GLYCOL[10 atoms]
A 20.0
/34.2
5
/5
NKG2D_HUMAN NKG2-D type II integral membrane protein
8ea8[2] I PGE
TRIETHYLENE GLYCOL[10 atoms]
B 25.0
/34.7
4
/4
NKG2D_HUMAN NKG2-D type II integral membrane protein
1ypq[2] C DIO
1,4-DIETHYLENE DIOXIDE[6 atoms]
A 25.0
/34.2
4
/4
P78380_HUMAN oxidised low density lipoprotein (lectin-like) rec..
6tla[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 33.3
/34.2
6
/10
OLR1_HUMAN Oxidized low-density lipoprotein receptor 1
6a7s[2] C TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 0.0
/34.2
3
/6
A0A2Z6G7U3_9BIVA N-acetylglucosamine-specific lectin
3ff7[1] E ACY
ACETIC ACID[4 atoms]
D 33.3
/33.9
6
/6
KLRG1_HUMAN Killer cell lectin-like receptor subfamily G membe..
1e8i[1] C SO4
SULFATE ION[5 atoms]
A 0.0
/31.1
1
/1
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
1e8i[1] C SO4
SULFATE ION[5 atoms]
B 0.0
/31.1
2
/2
CD69_HUMAN EARLY ACTIVATION ANTIGEN CD69
3zhg[16] E SO4
SULFATE ION[5 atoms]
A 0.0
/24.1
4
/4
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3zhg[6] F SO4
SULFATE ION[5 atoms]
A 0.0
/24.1
1
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3zhg[12] G SO4
SULFATE ION[5 atoms]
A 33.3
/24.1
3
/3
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3zhg[34] H SO4
SULFATE ION[5 atoms]
A 0.0
/24.1
4
/4
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
3zhg[8] J SO4
SULFATE ION[5 atoms]
A 100.0
/24.1
1
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[3] I SO4
SULFATE ION[5 atoms]
A 25.0
/24.1
4
/4
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[5] K SO4
SULFATE ION[5 atoms]
A 100.0
/24.1
1
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[4] L SO4
SULFATE ION[5 atoms]
B 42.9
/24.1
7
/7
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4c9f[9] O SO4
SULFATE ION[5 atoms]
B 20.0
/24.1
5
/5
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4caj[4] K SO4
SULFATE ION[5 atoms]
A 0.0
/24.1
2
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4caj[4] L SO4
SULFATE ION[5 atoms]
A 0.0
/24.1
2
/2
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4caj[2] X SO4
SULFATE ION[5 atoms]
B 0.0
/24.1
3
/3
C209B_MOUSE CD209 ANTIGEN-LIKE PROTEIN B
4gk1[5] K SO4
SULFATE ION[5 atoms]
A 25.0
/40.3
4
/4
FCER2_HUMAN Low affinity immunoglobulin epsilon Fc receptor
5k8y[9] D P6G
HEXAETHYLENE GLYCOL[10 atoms]
A 33.3
/30.6
3
/3
CLC4K_MOUSE C-type lectin domain family 4 member K
5k8y[2] F P6G
HEXAETHYLENE GLYCOL[16 atoms]
A 0.0
/30.6
5
/5
CLC4K_MOUSE C-type lectin domain family 4 member K
4wco[1] E ACT
ACETATE ION[4 atoms]
A 16.7
/30.6
6
/6
CLC2D_HUMAN C-type lectin domain family 2 member D
4wco[1] M ACT
ACETATE ION[4 atoms]
C 0.0
/30.6
1
/1
CLC2D_HUMAN C-type lectin domain family 2 member D
4wco[1] N ACT
ACETATE ION[4 atoms]
C 0.0
/30.6
3
/3
CLC2D_HUMAN C-type lectin domain family 2 member D
4zrv[2] J ACT
ACETATE ION[4 atoms]
A 0.0
/29.2
3
/6
E1BHM0_BOVIN Mincle CRD
6py1[2] C ACT
ACETATE ION[4 atoms]
A 0.0
/29.3
4
/4
CLC10_HUMAN C-type lectin domain family 10 member A
3wh2[1] D FLC
CITRATE ANION[13 atoms]
A 100.0
/28.1
2
/9
CLC4E_HUMAN C-type lectin domain family 4 member E
4kzw[1] C FLC
CITRATE ANION[13 atoms]
A 100.0
/29.2
2
/7
E1BHM0_BOVIN C-TYPE LECTIN MINCLE
1mpu[2] B PO4
PHOSPHATE ION[5 atoms]
A 0.0
/33.8
2
/5
NKG2D_HUMAN NKG2-D type II integral membrane protein
3m9z[14] B PO4
PHOSPHATE ION[5 atoms]
A 25.0
/28.4
4
/4
KLRBA_MOUSE Killer cell lectin-like receptor subfamily B membe..
7nl6[1] F NO3
NITRATE ION[4 atoms]
A 0.0
/28.7
4
/4
CD209_HUMAN DC-SIGN, CRD domain
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.