Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3178314 1170 395 P20701(ITAL_HUMAN) RecName: Full=Integrin alpha-L ;AltName: Full=CD11 antigen-like family member A;AltName: Full=Leukocyte adhesion glycoprotein LFA-1 alpha chain; Short=LFA-1A;AltName: Full=Leukocyte function-associated molecule 1 alpha chain;AltName: CD_antigen=CD11a;Flags: Precursor;
QUERYSEQ
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGAPGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCDQNTYLSGLCYLFRQNLQGPMLQGRPGFQEC
IKGNVDLVFLFDGSMSLQPDEFQKILDFMKDVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYVATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSRGHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLLASGAPRYQHMGRVLLFQEPQGGGHWSQVQT
IHGTQIGSYFGGELCGVDVDQDGETELLLIGAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVAVGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLIPQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSLNFSLWEEEGTPRDQRAQGKDI
PPILRPSLHSETWEIPFEKNCGEDKKCEANLRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASSMFS
LCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P20701(ITAL_HUMAN)]

1170
region name description
1-25 SIGNAL
26-1170 CHAIN /note="Integrin alpha-L" /id="PRO_0000016292"
26-1090 TOPO_DOM /note="Extracellular"
1091-1111 TRANSMEM /note="Helical"
1112-1170 TOPO_DOM /note="Cytoplasmic"
31-82 REPEAT /note="FG-GAP 1"
83-141 REPEAT /note="FG-GAP 2"
156-327 DOMAIN /note="VWFA"
338-389 REPEAT /note="FG-GAP 3"
390-445 REPEAT /note="FG-GAP 4"
446-506 REPEAT /note="FG-GAP 5"
507-563 REPEAT /note="FG-GAP 6"
567-627 REPEAT /note="FG-GAP 7"
1128-1170 REGION /note="Disordered"
1154-1170 COMPBIAS /note="Basic and acidic residues"
468-468 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="1"
470-470 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="1"
472-472 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="1"
476-476 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="1"
530-530 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="2"
532-532 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="2"
534-534 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="2"
538-538 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="2"
590-590 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="3"
594-594 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="3"
598-598 BINDING /ligand="Ca(2+)" /ligand_id="ChEBI:CHEBI:29108" /ligand_label="3"
1-1170 DISORDER predicted by DISOPRED

MONOMER
1170
pdb_id a1 identity[%]2 description
5e6u A 99.8
3k71 G 37.7
7usl A 37.2
2k8o A 98.3
2m3e A 100.0
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.