HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

880173

557

P17181(INAR1_HUMAN)

RecName: Full=Interferon alpha/beta receptor 1; Short=IFN-R-1; Short=IFN-alpha/beta receptor 1;AltName: Full=Cytokine receptor class-II member 1;AltName: Full=Cytokine receptor family 2 member 1; Short=CRF2-1;AltName: Full=Type I interferon receptor 1;Flags: Precursor;

QUERYSEQ

MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGT
KDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSWKIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQK
GIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSVFSDAVCEKTKPGNTSKIWLIVGICIALFAL
PFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNLLLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P17181(INAR1_HUMAN)]

557
	region	name	description
	1-27	SIGNAL
	28-557	CHAIN	/note="Interferon alpha/beta receptor 1" /id="PRO_0000011001"
	28-436	TOPO_DOM	/note="Extracellular"
	437-457	TRANSMEM	/note="Helical"
	458-557	TOPO_DOM	/note="Cytoplasmic"
	32-126	DOMAIN	/note="Fibronectin type-III 1"
	127-227	DOMAIN	/note="Fibronectin type-III 2"
	231-329	DOMAIN	/note="Fibronectin type-III 3"
	331-432	DOMAIN	/note="Fibronectin type-III 4"
	491-500	REGION	/note="Important for interaction with TYK2"
	516-557	REGION	/note="Disordered"
	540-557	COMPBIAS	/note="Basic and acidic residues"
	463-463	LIPID	/note="S-palmitoyl cysteine"
	1-557	DISORDER	predicted by DISOPRED

MONOMER

557

pdb_id a¹ identity[%]² description

3se4 A 100.0 INAR1_HUMAN Interferon alpha/beta receptor 1

3wcy A 48.9 INAR1_MOUSE Interferon alpha/beta receptor 1

4po6 B 100.0 INAR1_HUMAN Interferon alpha/beta receptor 1

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

557 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3se3[1] B Q86UP4_HUMAN Interferon alpha 2b[128 aa] A 100.0
/100.0 17
/17 INAR1_HUMAN Interferon alpha/beta receptor 1

3se4[1] B IFNW1_HUMAN Interferon omega-1[143 aa] A 100.0
/100.0 20
/20 INAR1_HUMAN Interferon alpha/beta receptor 1

4po6[1] A TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2[475 aa] B 100.0
/100.0 16
/16 INAR1_HUMAN Interferon alpha/beta receptor 1

3wcy[1] B IFNB_MOUSE Interferon beta[160 aa] A 25.0
/48.9 32
/32 INAR1_MOUSE Interferon alpha/beta receptor 1

6x93[1] A IL10_HUMAN Interleukin-10[135 aa] C 18.8
/31.6 16
/18 I10R2_HUMAN Interleukin-10 receptor subunit beta

6x93[1] B I10R1_HUMAN Interleukin-10 receptor subunit alpha[198 aa] C 25.0
/31.6 4
/4 I10R2_HUMAN Interleukin-10 receptor subunit beta

6x93[1] D IL10_HUMAN Interleukin-10[145 aa] F 0.0
/31.6 4
/5 I10R2_HUMAN Interleukin-10 receptor subunit beta

4doh[2] A IL20_HUMAN Interleukin-20[153 aa] C 20.0
/31.3 15
/18 I20RA_HUMAN Interleukin-20 receptor subunit alpha

5t5w[1] B INLR1_HUMAN Interferon lambda receptor 1[188 aa] A 18.2
/30.8 11
/13 I10R2_HUMAN Interleukin-10 receptor subunit beta

5t5w[1] C IFNL3_HUMAN Interferon lambda-3[151 aa] A 16.7
/30.8 12
/13 I10R2_HUMAN Interleukin-10 receptor subunit beta

6df3[1] B IL24_HUMAN Interleukin-24[155 aa] A 18.2
/26.1 11
/14 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6df3[1] B IL24_HUMAN Interleukin-24[155 aa] C 16.7
/29.3 18
/19 I20RB_HUMAN Interleukin-20 receptor subunit beta

6df3[1] A I22R1_HUMAN Interleukin-22 receptor subunit alpha-1[199 aa] C 50.0
/29.3 6
/8 I20RB_HUMAN Interleukin-20 receptor subunit beta

6weo[12] IA I22R1_MOUSE Interleukin-22 receptor subunit alpha-1[201 aa] A 33.3
/29.2 6
/6 I10R2_MOUSE Interleukin-10 receptor subunit beta

6e3k[4] B IFNG_HUMAN Interferon gamma[126 aa] E 15.4
/27.2 13
/14 INGR2_HUMAN Interferon gamma receptor 2

6e3k[4] D INGR1_HUMAN Interferon gamma receptor 1[203 aa] E 5.6
/27.2 18
/19 INGR2_HUMAN Interferon gamma receptor 2

3dgc[3] A IL22_HUMAN Interleukin-22[141 aa] B 23.1
/24.2 13
/16 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[2] C IL22_HUMAN Interleukin-22[141 aa] B 12.5
/24.2 8
/12 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6df3[1] C I20RB_HUMAN Interleukin-20 receptor subunit beta[190 aa] A 25.0
/26.1 8
/8 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6weo[12] JA IL22_MOUSE Interleukin-22[141 aa] A 20.0
/29.2 15
/17 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[12] C IL22_MOUSE Interleukin-22[140 aa] B 40.0
/22.1 10
/13 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[12] D I10R2_MOUSE Interleukin-10 receptor subunit beta[195 aa] B 66.7
/22.1 3
/7 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

557 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5eh1[5] B CYS
CYSTEINE[7 atoms] A 0.0
/27.2 3
/3 INGR2_HUMAN Interferon gamma receptor 2

3s98[2] B NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 3
/3 IFNAR1_HUMAN Interferon alpha/beta receptor 1

3se3[2] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 1
/1 INAR1_HUMAN Interferon alpha/beta receptor 1

4doh[1] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. C 0.0
/31.3 2
/2 I20RA_HUMAN Interleukin-20 receptor subunit alpha

5eh1[5] C NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 40.0
/27.2 5
/5 INGR2_HUMAN Interferon gamma receptor 2

5eh1[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 0.0
/27.2 2
/2 INGR2_HUMAN Interferon gamma receptor 2

6df3[1] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 50.0
/26.1 4
/4 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6e3k[2] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. E 0.0
/27.2 1
/1 INGR2_HUMAN Interferon gamma receptor 2

6e3l[1] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. E 100.0
/27.2 2
/4 INGR2_HUMAN Interferon gamma receptor 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

557 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3dgc[2] H CL
CHLORIDE ION[1 atoms] B 20.0
/24.2 5
/6 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[1] S CL
CHLORIDE ION[1 atoms] D 33.3
/24.2 3
/3 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[2] I U1
URANIUM ATOM[1 atoms] B 0.0
/24.2 1
/1 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[1] J U1
URANIUM ATOM[1 atoms] B 0.0
/24.2 1
/2 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[2] K U1
URANIUM ATOM[1 atoms] B 33.3
/24.2 3
/3 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3dgc[1] L U1
URANIUM ATOM[1 atoms] B 100.0
/24.2 1
/2 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

557 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6df3[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 20.0
/26.1 5
/6 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6e3k[3] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. E 20.0
/27.2 5
/5 INGR2_HUMAN Interferon gamma receptor 2

6weo[1] AB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. BA 0.0
/29.2 1
/1 I10R2_MOUSE Interleukin-10 receptor subunit beta

6e3l[2] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. E 25.0
/27.2 4
/4 INGR2_HUMAN Interferon gamma receptor 2

6weo[1] QA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. K 25.0
/22.1 4
/4 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[1] QA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. M 100.0
/29.2 1
/1 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[1] GB alpha-L-fucopyranose-(1-3)-[alpha-L-fucopyranose-(.. A 50.0
/29.2 2
/2 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[4] CB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. EA 0.0
/29.2 2
/2 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[2] OA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. H 25.0
/22.1 4
/7 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[1] OA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. J 0.0
/29.8 1
/1 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[1] RA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. O 0.0
/29.2 2
/2 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[1] UA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. S 25.0
/22.1 4
/8 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[1] UA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. U 100.0
/29.2 1
/1 I10R2_MOUSE Interleukin-10 receptor subunit beta

6e3k[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. F 20.0
/27.2 5
/5 INGR2_HUMAN Interferon gamma receptor 2

6e3l[1] L alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-.. F 20.0
/27.2 5
/5 INGR2_HUMAN Interferon gamma receptor 2

3dgc[1] E alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 28.6
/24.2 7
/7 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6weo[3] KA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 25.0
/22.1 4
/8 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[4] BB alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. CA 25.0
/22.1 4
/8 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6weo[3] NA alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. G 50.0
/29.2 2
/2 I10R2_MOUSE Interleukin-10 receptor subunit beta

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

557 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3lqm[2] C SO4
SULFATE ION[5 atoms] A 40.0
/30.4 5
/5 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[2] D SO4
SULFATE ION[5 atoms] A 50.0
/30.4 4
/4 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[2] E SO4
SULFATE ION[5 atoms] A 50.0
/30.4 2
/2 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[1] G SO4
SULFATE ION[5 atoms] B 50.0
/30.8 4
/6 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[1] H SO4
SULFATE ION[5 atoms] B 33.3
/30.8 3
/3 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[1] L SO4
SULFATE ION[5 atoms] B 0.0
/30.8 2
/2 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[1] M SO4
SULFATE ION[5 atoms] B 100.0
/30.8 2
/2 I10R2_HUMAN Interleukin-10 receptor subunit beta

3lqm[1] F GOL
GLYCEROL[6 atoms] A 20.0
/30.4 5
/5 I10R2_HUMAN Interleukin-10 receptor subunit beta

5eh1[1] F GOL
GLYCEROL[6 atoms] A 0.0
/27.2 4
/4 INGR2_HUMAN Interferon gamma receptor 2

5eh1[1] G GOL
GLYCEROL[6 atoms] A 42.9
/27.2 7
/9 INGR2_HUMAN Interferon gamma receptor 2

5eh1[1] H GOL
GLYCEROL[6 atoms] A 40.0
/27.2 5
/5 INGR2_HUMAN Interferon gamma receptor 2

6df3[1] F GOL
GLYCEROL[6 atoms] A 0.0
/26.1 2
/2 I22R1_HUMAN Interleukin-22 receptor subunit alpha-1

6weo[1] JB GOL
GLYCEROL[6 atoms] R 0.0
/29.2 2
/2 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[2] LB GOL
GLYCEROL[6 atoms] U 0.0
/29.2 2
/3 I10R2_MOUSE Interleukin-10 receptor subunit beta

6weo[1] MB GOL
GLYCEROL[6 atoms] W 0.0
/22.1 4
/7 I22R1_MOUSE Interleukin-22 receptor subunit alpha-1

6e3k[1] AA EDO
1,2-ETHANEDIOL[4 atoms] F 100.0
/27.2 1
/2 INGR2_HUMAN Interferon gamma receptor 2

6e3k[1] BA EDO
1,2-ETHANEDIOL[4 atoms] F 100.0
/27.2 2
/3 INGR2_HUMAN Interferon gamma receptor 2

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
557
	pdb_id	a¹	identity[%]²	description
	3se4	A	100.0	INAR1_HUMAN Interferon alpha/beta receptor 1
	3wcy	A	48.9	INAR1_MOUSE Interferon alpha/beta receptor 1
	4po6	B	100.0	INAR1_HUMAN Interferon alpha/beta receptor 1
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
557	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3se3[1]	B	Q86UP4_HUMAN Interferon alpha 2b[128 aa]	A	100.0 /100.0	17 /17	INAR1_HUMAN Interferon alpha/beta receptor 1
	3se4[1]	B	IFNW1_HUMAN Interferon omega-1[143 aa]	A	100.0 /100.0	20 /20	INAR1_HUMAN Interferon alpha/beta receptor 1
	4po6[1]	A	TYK2_HUMAN Non-receptor tyrosine-protein kinase TYK2[475 aa]	B	100.0 /100.0	16 /16	INAR1_HUMAN Interferon alpha/beta receptor 1
	3wcy[1]	B	IFNB_MOUSE Interferon beta[160 aa]	A	25.0 /48.9	32 /32	INAR1_MOUSE Interferon alpha/beta receptor 1
	6x93[1]	A	IL10_HUMAN Interleukin-10[135 aa]	C	18.8 /31.6	16 /18	I10R2_HUMAN Interleukin-10 receptor subunit beta
	6x93[1]	B	I10R1_HUMAN Interleukin-10 receptor subunit alpha[198 aa]	C	25.0 /31.6	4 /4	I10R2_HUMAN Interleukin-10 receptor subunit beta
	6x93[1]	D	IL10_HUMAN Interleukin-10[145 aa]	F	0.0 /31.6	4 /5	I10R2_HUMAN Interleukin-10 receptor subunit beta
	4doh[2]	A	IL20_HUMAN Interleukin-20[153 aa]	C	20.0 /31.3	15 /18	I20RA_HUMAN Interleukin-20 receptor subunit alpha
	5t5w[1]	B	INLR1_HUMAN Interferon lambda receptor 1[188 aa]	A	18.2 /30.8	11 /13	I10R2_HUMAN Interleukin-10 receptor subunit beta
	5t5w[1]	C	IFNL3_HUMAN Interferon lambda-3[151 aa]	A	16.7 /30.8	12 /13	I10R2_HUMAN Interleukin-10 receptor subunit beta
	6df3[1]	B	IL24_HUMAN Interleukin-24[155 aa]	A	18.2 /26.1	11 /14	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6df3[1]	B	IL24_HUMAN Interleukin-24[155 aa]	C	16.7 /29.3	18 /19	I20RB_HUMAN Interleukin-20 receptor subunit beta
	6df3[1]	A	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1[199 aa]	C	50.0 /29.3	6 /8	I20RB_HUMAN Interleukin-20 receptor subunit beta
	6weo[12]	IA	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1[201 aa]	A	33.3 /29.2	6 /6	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6e3k[4]	B	IFNG_HUMAN Interferon gamma[126 aa]	E	15.4 /27.2	13 /14	INGR2_HUMAN Interferon gamma receptor 2
	6e3k[4]	D	INGR1_HUMAN Interferon gamma receptor 1[203 aa]	E	5.6 /27.2	18 /19	INGR2_HUMAN Interferon gamma receptor 2
	3dgc[3]	A	IL22_HUMAN Interleukin-22[141 aa]	B	23.1 /24.2	13 /16	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[2]	C	IL22_HUMAN Interleukin-22[141 aa]	B	12.5 /24.2	8 /12	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6df3[1]	C	I20RB_HUMAN Interleukin-20 receptor subunit beta[190 aa]	A	25.0 /26.1	8 /8	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6weo[12]	JA	IL22_MOUSE Interleukin-22[141 aa]	A	20.0 /29.2	15 /17	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[12]	C	IL22_MOUSE Interleukin-22[140 aa]	B	40.0 /22.1	10 /13	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[12]	D	I10R2_MOUSE Interleukin-10 receptor subunit beta[195 aa]	B	66.7 /22.1	3 /7	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
557	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	5eh1[5]	B	CYS CYSTEINE[7 atoms]	A	0.0 /27.2	3 /3	INGR2_HUMAN Interferon gamma receptor 2
	3s98[2]	B	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	3 /3	IFNAR1_HUMAN Interferon alpha/beta receptor 1
	3se3[2]	D	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	1 /1	INAR1_HUMAN Interferon alpha/beta receptor 1
	4doh[1]	H	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	C	0.0 /31.3	2 /2	I20RA_HUMAN Interleukin-20 receptor subunit alpha
	5eh1[5]	C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	40.0 /27.2	5 /5	INGR2_HUMAN Interferon gamma receptor 2
	5eh1[3]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	0.0 /27.2	2 /2	INGR2_HUMAN Interferon gamma receptor 2
	6df3[1]	E	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	50.0 /26.1	4 /4	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6e3k[2]	U	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	E	0.0 /27.2	1 /1	INGR2_HUMAN Interferon gamma receptor 2
	6e3l[1]	R	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	E	100.0 /27.2	2 /4	INGR2_HUMAN Interferon gamma receptor 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
557	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3dgc[2]	H	CL CHLORIDE ION[1 atoms]	B	20.0 /24.2	5 /6	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[1]	S	CL CHLORIDE ION[1 atoms]	D	33.3 /24.2	3 /3	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[2]	I	U1 URANIUM ATOM[1 atoms]	B	0.0 /24.2	1 /1	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[1]	J	U1 URANIUM ATOM[1 atoms]	B	0.0 /24.2	1 /2	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[2]	K	U1 URANIUM ATOM[1 atoms]	B	33.3 /24.2	3 /3	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3dgc[1]	L	U1 URANIUM ATOM[1 atoms]	B	100.0 /24.2	1 /2	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
557	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6df3[1]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	20.0 /26.1	5 /6	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6e3k[3]	G	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	E	20.0 /27.2	5 /5	INGR2_HUMAN Interferon gamma receptor 2
	6weo[1]	AB	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	BA	0.0 /29.2	1 /1	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6e3l[2]	I	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	E	25.0 /27.2	4 /4	INGR2_HUMAN Interferon gamma receptor 2
	6weo[1]	QA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	K	25.0 /22.1	4 /4	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[1]	QA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	M	100.0 /29.2	1 /1	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[1]	GB	alpha-L-fucopyranose-(1-3)-[alpha-L-fucopyranose-(..	A	50.0 /29.2	2 /2	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[4]	CB	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	EA	0.0 /29.2	2 /2	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[2]	OA	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	H	25.0 /22.1	4 /7	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[1]	OA	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	J	0.0 /29.8	1 /1	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[1]	RA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	O	0.0 /29.2	2 /2	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[1]	UA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	S	25.0 /22.1	4 /8	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[1]	UA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	U	100.0 /29.2	1 /1	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6e3k[1]	H	alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose..	F	20.0 /27.2	5 /5	INGR2_HUMAN Interferon gamma receptor 2
	6e3l[1]	L	alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-..	F	20.0 /27.2	5 /5	INGR2_HUMAN Interferon gamma receptor 2
	3dgc[1]	E	alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(..	B	28.6 /24.2	7 /7	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6weo[3]	KA	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet..	B	25.0 /22.1	4 /8	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[4]	BB	alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet..	CA	25.0 /22.1	4 /8	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6weo[3]	NA	alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet..	G	50.0 /29.2	2 /2	I10R2_MOUSE Interleukin-10 receptor subunit beta
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
557	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3lqm[2]	C	SO4 SULFATE ION[5 atoms]	A	40.0 /30.4	5 /5	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[2]	D	SO4 SULFATE ION[5 atoms]	A	50.0 /30.4	4 /4	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[2]	E	SO4 SULFATE ION[5 atoms]	A	50.0 /30.4	2 /2	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[1]	G	SO4 SULFATE ION[5 atoms]	B	50.0 /30.8	4 /6	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[1]	H	SO4 SULFATE ION[5 atoms]	B	33.3 /30.8	3 /3	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[1]	L	SO4 SULFATE ION[5 atoms]	B	0.0 /30.8	2 /2	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[1]	M	SO4 SULFATE ION[5 atoms]	B	100.0 /30.8	2 /2	I10R2_HUMAN Interleukin-10 receptor subunit beta
	3lqm[1]	F	GOL GLYCEROL[6 atoms]	A	20.0 /30.4	5 /5	I10R2_HUMAN Interleukin-10 receptor subunit beta
	5eh1[1]	F	GOL GLYCEROL[6 atoms]	A	0.0 /27.2	4 /4	INGR2_HUMAN Interferon gamma receptor 2
	5eh1[1]	G	GOL GLYCEROL[6 atoms]	A	42.9 /27.2	7 /9	INGR2_HUMAN Interferon gamma receptor 2
	5eh1[1]	H	GOL GLYCEROL[6 atoms]	A	40.0 /27.2	5 /5	INGR2_HUMAN Interferon gamma receptor 2
	6df3[1]	F	GOL GLYCEROL[6 atoms]	A	0.0 /26.1	2 /2	I22R1_HUMAN Interleukin-22 receptor subunit alpha-1
	6weo[1]	JB	GOL GLYCEROL[6 atoms]	R	0.0 /29.2	2 /2	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[2]	LB	GOL GLYCEROL[6 atoms]	U	0.0 /29.2	2 /3	I10R2_MOUSE Interleukin-10 receptor subunit beta
	6weo[1]	MB	GOL GLYCEROL[6 atoms]	W	0.0 /22.1	4 /7	I22R1_MOUSE Interleukin-22 receptor subunit alpha-1
	6e3k[1]	AA	EDO 1,2-ETHANEDIOL[4 atoms]	F	100.0 /27.2	1 /2	INGR2_HUMAN Interferon gamma receptor 2
	6e3k[1]	BA	EDO 1,2-ETHANEDIOL[4 atoms]	F	100.0 /27.2	2 /3	INGR2_HUMAN Interferon gamma receptor 2
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [P17181(INAR1_HUMAN)]