Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1688700 | 125 | 0 | P13164(IFM1_HUMAN) | RecName: Full=Interferon-induced transmembrane protein 1 ;AltName: Full=Dispanin subfamily A member 2a; Short=DSPA2a;AltName: Full=Interferon-induced protein 17;AltName: Full=Interferon-inducible protein 9-27;AltName: Full=Leu-13 antigen;AltName: CD_antigen=CD225; |
QUERYSEQ |
MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY |
125 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-125 | CHAIN | /note="Interferon-induced transmembrane protein 1" /id="PRO_0000153727" |
![]() ![]() |
1-36 | TOPO_DOM | /note="Cytoplasmic" |
![]() ![]() ![]() |
58-86 | TOPO_DOM | /note="Cytoplasmic" |
![]() ![]() ![]() |
87-107 | TRANSMEM | /note="Helical" |
![]() ![]() |
108-125 | TOPO_DOM | /note="Extracellular" |
![]() ![]() |
84-125 | REGION | /note="Interaction with CAV1" |
![]() ![]() ![]() |
50-50 | LIPID | /note="S-palmitoyl cysteine" |
![]() ![]() ![]() |
51-51 | LIPID | /note="S-palmitoyl cysteine" |
![]() ![]() ![]() |
84-84 | LIPID | /note="S-palmitoyl cysteine" |
![]() ![]() ![]() |
1-125 | DISORDER | predicted by DISOPRED |