Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
864691 41 0 P0DTG1(ORF3C_SARS2) RecName: Full=ORF3c protein ; Short=ORF3c;AltName: Full=ORF3h protein ; Short=ORF3h;
QUERYSEQ
MLLLQILFALLQRYRYKPHSLSDGLLLALHFLLFFRALPKS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTG1(ORF3C_SARS2)]

41
region name description
1-1 DISORDER predicted by DISOPRED

No homologue is found in PDB.

Please check [SiteTable] for homologues.