HOMCOS(prot_sch_conbars.cgi):

[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

20702

419

110

P0DTC9(NCAP_SARS2)

RecName: Full=Nucleoprotein ; Short=N;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ;

QUERYSEQ

MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN
PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC9(NCAP_SARS2)]

419
	region	name	description
	1-419	CHAIN	/note="Nucleoprotein" /id="PRO_0000449656"
	48-175	DOMAIN	/note="CoV N NTD"
	247-364	DOMAIN	/note="CoV N CTD"
	41-186	REGION	/note="RNA-binding"
	258-361	REGION	/note="Dimerization"
	1-419	DISORDER	predicted by DISOPRED (1-45,177-217,229-257,368-392,409-419)

MONOMER

419

pdb_id a¹ identity[%]² description

7acs A 99.3 NCAP_SARS2 Nucleoprotein

6yun B 100.0 NCAP_SARS2 Nucleoprotein

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

NUCLEOTIDE

419 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

7act[1] B ssRNA A 100.0
/100.0 28
/28 NCAP_SARS2 Nucleoprotein

7acs[1] C RNA (5'-R(P*GP*UP*CP*AP*GP*UP*G)-3') A 100.0
/99.3 11
/11 NCAP_SARS2 Nucleoprotein

7acs[1] B RNA (5'-R(P*CP*AP*CP*UP*GP*AP*C)-3') A 100.0
/99.3 5
/5 NCAP_SARS2 Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

419 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. D 57.1
/62.2 7
/7 A0A0D3MU65_9BETC Nucleoprotein

6kl6[1] E DJU
N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth.. B 83.3
/61.2 6
/6 A0A0D3MU65_9BETC Nucleoprotein

6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. C 50.0
/62.1 4
/4 A0A0D3MU65_9BETC Nucleoprotein

6kl5[1] E DJO
(phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi.. A 75.0
/60.5 4
/4 A0A0D3MU65_9BETC Nucleoprotein

4lm7[1] B U5P
URIDINE-5'-MONOPHOSPHATE[21 atoms] A 80.0
/50.0 10
/14 Q6SA23_CVHOC Nucleoprotein

4li4[1] B AMP
ADENOSINE MONOPHOSPHATE[23 atoms] A 80.0
/50.0 10
/14 Q6SA23_CVHOC Nucleoprotein

4lmt[1] B CQD
6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli.. A 83.3
/49.6 6
/10 Q6SA23_CVHOC Nucleoprotein

4lmc[1] B C5P
CYTIDINE-5'-MONOPHOSPHATE[21 atoms] A 88.9
/49.6 9
/13 Q6SA23_CVHOC Nucleoprotein

4lm9[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 80.0
/49.6 10
/14 Q6SA23_CVHOC Nucleoprotein

4kxj[1] B P34
N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH.. A 50.0
/49.2 6
/10 Q6SA23_CVHOC Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

419 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6vyo[8] H ZN
ZINC ION[1 atoms] A 100.0
/100.0 3
/3 NCAP_SARS2 Nucleoprotein

6vyo[8] R ZN
ZINC ION[1 atoms] C 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

6wji[6] L CL
CHLORIDE ION[1 atoms] E 100.0
/100.0 1
/1 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6wji[4] H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6g13[1] I CL
CHLORIDE ION[1 atoms] B 50.0
/55.1 2
/2 A0A0D3MU51_9BETC Nucleoprotein

6wji[3] M CL
CHLORIDE ION[1 atoms] E 100.0
/100.0 2
/2 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6vyo[4] O CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 5
/5 NCAP_SARS2 Nucleoprotein

6vyo[4] I CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

4ud1[3] N NH4
AMMONIUM ION[1 atoms] E 0.0
/60.9 2
/2 T2B9R0_9BETC N PROTEIN

4ud1[1] J NH4
AMMONIUM ION[1 atoms] C 100.0
/59.1 1
/1 T2B9R0_9BETC N PROTEIN

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

419 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6wkp[7] D NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[115 aa] C 100.0
/100.0 14
/14 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6wkp[7] B NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[117 aa] C 100.0
/100.0 6
/6 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6wkp[1] A NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa] D 100.0
/100.0 6
/6 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6wkp[1] A NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa] B 100.0
/100.0 8
/8 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

2cjr[42] H NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa] G 98.0
/95.4 49
/49 NCAP_CVHSA NUCLEOCAPSID PROTEIN

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] B 100.0
/95.8 3
/3 NCAP_CVHSA Nucleocapsid protein

2gib[2] B NCAP_CVHSA Nucleocapsid protein[96 aa] A 100.0
/95.9 1
/1 NCAP_CVHSA Nucleocapsid protein

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/95.9 8
/8 NCAP_CVHSA Nucleocapsid protein

2gib[2] A NCAP_CVHSA Nucleocapsid protein[97 aa] A 100.0
/95.9 6
/6 NCAP_CVHSA Nucleocapsid protein

6kl2[12] A A0A0D3MU65_9BETC Nucleoprotein[116 aa] C 54.5
/62.5 11
/11 A0A0D3MU65_9BETC Nucleoprotein

6g13[4] B A0A0D3MU51_9BETC Nucleoprotein[113 aa] D 58.6
/55.1 58
/58 A0A0D3MU51_9BETC Nucleoprotein

5n4k[2] A NCAP_CVHNL Nucleoprotein[130 aa] B 41.7
/47.6 12
/22 NCAP_CVHNL Nucleoprotein

2gec[1] A NCAP_IBVG Nucleocapsid protein[138 aa] B 35.0
/40.7 20
/25 NCAP_IBVG Nucleocapsid protein

2gec[1] B NCAP_IBVG Nucleocapsid protein[139 aa] A 27.8
/40.7 18
/18 NCAP_IBVG Nucleocapsid protein

5epw[2] B NCAP_CVHNL Nucleoprotein[110 aa] A 31.4
/38.0 51
/54 NCAP_CVHNL Nucleoprotein

2ge8[10] A NCAP_IBVG Nucleocapsid protein[112 aa] B 34.5
/29.1 55
/57 NCAP_IBVG Nucleocapsid protein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

419 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6vyo[2] K GOL
GLYCEROL[6 atoms] B 100.0
/100.0 3
/3 NCAP_SARS2 Nucleoprotein

6vyo[2] P GOL
GLYCEROL[6 atoms] C 100.0
/100.0 6
/6 NCAP_SARS2 Nucleoprotein

4ud1[2] L GOL
GLYCEROL[6 atoms] C 66.7
/59.1 3
/3 T2B9R0_9BETC N PROTEIN

4ud1[1] M GOL
GLYCEROL[6 atoms] D 0.0
/60.7 3
/3 T2B9R0_9BETC N PROTEIN

5n4k[4] N SO4
SULFATE ION[5 atoms] B 33.3
/47.6 3
/3 NCAP_CVHNL Nucleoprotein

6wzq[3] J SO4
SULFATE ION[5 atoms] D 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

2gib[5] C SO4
SULFATE ION[5 atoms] A 100.0
/95.9 2
/2 NCAP_CVHSA Nucleocapsid protein

5n4k[3] P SO4
SULFATE ION[5 atoms] B 66.7
/47.6 3
/5 NCAP_CVHNL Nucleoprotein

5n4k[2] N SO4
SULFATE ION[5 atoms] A 0.0
/46.0 1
/1 NCAP_CVHNL Nucleoprotein

6wzq[1] I SO4
SULFATE ION[5 atoms] C 100.0
/100.0 3
/3 NCAP_SARS2 Nucleoprotein

5n4k[1] I SO4
SULFATE ION[5 atoms] A 50.0
/46.0 2
/2 NCAP_CVHNL Nucleoprotein

6wzq[1] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

6wkp[6] F MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] B 100.0
/100.0 4
/4 NCAP_SARS2 SARS-CoV-2 nucleocapsid protein

6vyo[6] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] D 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

7c22[2] G ACT
ACETATE ION[4 atoms] D 100.0
/100.0 1
/1 NCAP_SARS2 Nucleoprotein

7c22[2] G ACT
ACETATE ION[4 atoms] C 100.0
/100.0 3
/3 NCAP_SARS2 Nucleoprotein

2ofz[1] B EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/92.1 2
/2 NCAP_CVHSA Nucleocapsid protein

4ud1[2] K IMD
IMIDAZOLE[5 atoms] C 100.0
/59.1 1
/1 T2B9R0_9BETC N PROTEIN

7c22[1] F PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 3
/3 NCAP_SARS2 Nucleoprotein

6g13[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 80.0
/55.2 5
/5 A0A0D3MU51_9BETC Nucleoprotein

6g13[3] F TMO
trimethylamine oxide[5 atoms] A 66.7
/55.2 3
/3 A0A0D3MU51_9BETC Nucleoprotein

6g13[1] E TMO
trimethylamine oxide[5 atoms] A 0.0
/55.2 1
/1 A0A0D3MU51_9BETC Nucleoprotein

4j3k[1] B TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms] A 44.4
/50.0 9
/9 Q6SA23_CVHOC Nucleoprotein

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
419
	pdb_id	a¹	identity[%]²	description
	7acs	A	99.3	NCAP_SARS2 Nucleoprotein
	6yun	B	100.0	NCAP_SARS2 Nucleoprotein
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

NUCLEOTIDE
419	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	7act[1]	B	ssRNA	A	100.0 /100.0	28 /28	NCAP_SARS2 Nucleoprotein
	7acs[1]	C	RNA (5'-R(PGPUPCPAPGPUP*G)-3')	A	100.0 /99.3	11 /11	NCAP_SARS2 Nucleoprotein
	7acs[1]	B	RNA (5'-R(PCPAPCPUPGPAP*C)-3')	A	100.0 /99.3	5 /5	NCAP_SARS2 Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
419	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6kl6[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	D	57.1 /62.2	7 /7	A0A0D3MU65_9BETC Nucleoprotein
	6kl6[1]	E	DJU N,N-dimethyl-1-(5-phenylmethoxy-1H-indol-3-yl)meth..	B	83.3 /61.2	6 /6	A0A0D3MU65_9BETC Nucleoprotein
	6kl5[1]	E	DJO (phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..	C	50.0 /62.1	4 /4	A0A0D3MU65_9BETC Nucleoprotein
	6kl5[1]	E	DJO (phenylmethyl) (2S)-2-(hydroxymethyl)-2,3-dihydroi..	A	75.0 /60.5	4 /4	A0A0D3MU65_9BETC Nucleoprotein
	4lm7[1]	B	U5P URIDINE-5'-MONOPHOSPHATE[21 atoms]	A	80.0 /50.0	10 /14	Q6SA23_CVHOC Nucleoprotein
	4li4[1]	B	AMP ADENOSINE MONOPHOSPHATE[23 atoms]	A	80.0 /50.0	10 /14	Q6SA23_CVHOC Nucleoprotein
	4lmt[1]	B	CQD 6-chloro-7-{[2-(morpholin-4-yl)ethyl]amino}quinoli..	A	83.3 /49.6	6 /10	Q6SA23_CVHOC Nucleoprotein
	4lmc[1]	B	C5P CYTIDINE-5'-MONOPHOSPHATE[21 atoms]	A	88.9 /49.6	9 /13	Q6SA23_CVHOC Nucleoprotein
	4lm9[1]	B	5GP GUANOSINE-5'-MONOPHOSPHATE[24 atoms]	A	80.0 /49.6	10 /14	Q6SA23_CVHOC Nucleoprotein
	4kxj[1]	B	P34 N~2~,N~2~-DIMETHYL-N~1~-(6-OXO-5,6-DIHYDROPHENANTH..	A	50.0 /49.2	6 /10	Q6SA23_CVHOC Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
419	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6vyo[8]	H	ZN ZINC ION[1 atoms]	A	100.0 /100.0	3 /3	NCAP_SARS2 Nucleoprotein
	6vyo[8]	R	ZN ZINC ION[1 atoms]	C	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	6wji[6]	L	CL CHLORIDE ION[1 atoms]	E	100.0 /100.0	1 /1	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6wji[4]	H	CL CHLORIDE ION[1 atoms]	A	100.0 /100.0	1 /1	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6g13[1]	I	CL CHLORIDE ION[1 atoms]	B	50.0 /55.1	2 /2	A0A0D3MU51_9BETC Nucleoprotein
	6wji[3]	M	CL CHLORIDE ION[1 atoms]	E	100.0 /100.0	2 /2	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6vyo[4]	O	CL CHLORIDE ION[1 atoms]	D	100.0 /100.0	5 /5	NCAP_SARS2 Nucleoprotein
	6vyo[4]	I	CL CHLORIDE ION[1 atoms]	D	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	4ud1[3]	N	NH4 AMMONIUM ION[1 atoms]	E	0.0 /60.9	2 /2	T2B9R0_9BETC N PROTEIN
	4ud1[1]	J	NH4 AMMONIUM ION[1 atoms]	C	100.0 /59.1	1 /1	T2B9R0_9BETC N PROTEIN
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
419	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6wkp[7]	D	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[115 aa]	C	100.0 /100.0	14 /14	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6wkp[7]	B	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[117 aa]	C	100.0 /100.0	6 /6	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6wkp[1]	A	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa]	D	100.0 /100.0	6 /6	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6wkp[1]	A	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein[103 aa]	B	100.0 /100.0	8 /8	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	2cjr[42]	H	NCAP_CVHSA NUCLEOCAPSID PROTEIN[110 aa]	G	98.0 /95.4	49 /49	NCAP_CVHSA NUCLEOCAPSID PROTEIN
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	B	100.0 /95.8	3 /3	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	B	NCAP_CVHSA Nucleocapsid protein[96 aa]	A	100.0 /95.9	1 /1	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	A	100.0 /95.9	8 /8	NCAP_CVHSA Nucleocapsid protein
	2gib[2]	A	NCAP_CVHSA Nucleocapsid protein[97 aa]	A	100.0 /95.9	6 /6	NCAP_CVHSA Nucleocapsid protein
	6kl2[12]	A	A0A0D3MU65_9BETC Nucleoprotein[116 aa]	C	54.5 /62.5	11 /11	A0A0D3MU65_9BETC Nucleoprotein
	6g13[4]	B	A0A0D3MU51_9BETC Nucleoprotein[113 aa]	D	58.6 /55.1	58 /58	A0A0D3MU51_9BETC Nucleoprotein
	5n4k[2]	A	NCAP_CVHNL Nucleoprotein[130 aa]	B	41.7 /47.6	12 /22	NCAP_CVHNL Nucleoprotein
	2gec[1]	A	NCAP_IBVG Nucleocapsid protein[138 aa]	B	35.0 /40.7	20 /25	NCAP_IBVG Nucleocapsid protein
	2gec[1]	B	NCAP_IBVG Nucleocapsid protein[139 aa]	A	27.8 /40.7	18 /18	NCAP_IBVG Nucleocapsid protein
	5epw[2]	B	NCAP_CVHNL Nucleoprotein[110 aa]	A	31.4 /38.0	51 /54	NCAP_CVHNL Nucleoprotein
	2ge8[10]	A	NCAP_IBVG Nucleocapsid protein[112 aa]	B	34.5 /29.1	55 /57	NCAP_IBVG Nucleocapsid protein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
419	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	6vyo[2]	K	GOL GLYCEROL[6 atoms]	B	100.0 /100.0	3 /3	NCAP_SARS2 Nucleoprotein
	6vyo[2]	P	GOL GLYCEROL[6 atoms]	C	100.0 /100.0	6 /6	NCAP_SARS2 Nucleoprotein
	4ud1[2]	L	GOL GLYCEROL[6 atoms]	C	66.7 /59.1	3 /3	T2B9R0_9BETC N PROTEIN
	4ud1[1]	M	GOL GLYCEROL[6 atoms]	D	0.0 /60.7	3 /3	T2B9R0_9BETC N PROTEIN
	5n4k[4]	N	SO4 SULFATE ION[5 atoms]	B	33.3 /47.6	3 /3	NCAP_CVHNL Nucleoprotein
	6wzq[3]	J	SO4 SULFATE ION[5 atoms]	D	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	2gib[5]	C	SO4 SULFATE ION[5 atoms]	A	100.0 /95.9	2 /2	NCAP_CVHSA Nucleocapsid protein
	5n4k[3]	P	SO4 SULFATE ION[5 atoms]	B	66.7 /47.6	3 /5	NCAP_CVHNL Nucleoprotein
	5n4k[2]	N	SO4 SULFATE ION[5 atoms]	A	0.0 /46.0	1 /1	NCAP_CVHNL Nucleoprotein
	6wzq[1]	I	SO4 SULFATE ION[5 atoms]	C	100.0 /100.0	3 /3	NCAP_SARS2 Nucleoprotein
	5n4k[1]	I	SO4 SULFATE ION[5 atoms]	A	50.0 /46.0	2 /2	NCAP_CVHNL Nucleoprotein
	6wzq[1]	F	SO4 SULFATE ION[5 atoms]	A	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	6wkp[6]	F	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	B	100.0 /100.0	4 /4	NCAP_SARS2 SARS-CoV-2 nucleocapsid protein
	6vyo[6]	E	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]	D	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	7c22[2]	G	ACT ACETATE ION[4 atoms]	D	100.0 /100.0	1 /1	NCAP_SARS2 Nucleoprotein
	7c22[2]	G	ACT ACETATE ION[4 atoms]	C	100.0 /100.0	3 /3	NCAP_SARS2 Nucleoprotein
	2ofz[1]	B	EDO 1,2-ETHANEDIOL[4 atoms]	A	100.0 /92.1	2 /2	NCAP_CVHSA Nucleocapsid protein
	4ud1[2]	K	IMD IMIDAZOLE[5 atoms]	C	100.0 /59.1	1 /1	T2B9R0_9BETC N PROTEIN
	7c22[1]	F	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	100.0 /100.0	3 /3	NCAP_SARS2 Nucleoprotein
	6g13[1]	G	PEG DI(HYDROXYETHYL)ETHER[7 atoms]	A	80.0 /55.2	5 /5	A0A0D3MU51_9BETC Nucleoprotein
	6g13[3]	F	TMO trimethylamine oxide[5 atoms]	A	66.7 /55.2	3 /3	A0A0D3MU51_9BETC Nucleoprotein
	6g13[1]	E	TMO trimethylamine oxide[5 atoms]	A	0.0 /55.2	1 /1	A0A0D3MU51_9BETC Nucleoprotein
	4j3k[1]	B	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]	A	44.4 /50.0	9 /9	Q6SA23_CVHOC Nucleoprotein
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Summary Bars[0.0 %]

UniProt Feature Tables [P0DTC9(NCAP_SARS2)]