Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
879330 61 6 P0DTC6(NS6_SARS2) RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3;
QUERYSEQ 
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC6(NS6_SARS2)]

61
region name description
1-61 CHAIN /note="ORF6 protein" /id="PRO_0000449653"
18-24 REGION /note="Important for host Golgi localization"
60-61 DISORDER predicted by DISOPRED

MONOMER
61
pdb_id a1 identity[%]2 description 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
61 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7f60[2] A RAE1L_HUMAN mRNA export factor[331 aa] E 100.0
/100.0		 9
/9		 NS6_SARS2 ORF6 protein
7vph[4] C RAE1L_HUMAN mRNA export factor[337 aa] I 100.0
/100.0		 9
/9		 NS6_SARS2 ORF6 protein
7vph[1] B NUP98_HUMAN Isoform 3 of Nuclear pore complex protein Nup98-Nu.. L 100.0
/100.0		 1
/1		 NS6_SARS2 ORF6 protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.