Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1696891 222 12 P0DTC5(VME1_SARS2) RecName: Full=Membrane protein ; Short=M;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ;
QUERYSEQ 
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR
IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC5(VME1_SARS2)]

222
region name description
1-222 CHAIN /note="Membrane protein" /id="PRO_0000449652"
2-19 TOPO_DOM /note="Virion surface"
20-40 TRANSMEM /note="Helical"
41-50 TOPO_DOM /note="Intravirion"
51-71 TRANSMEM /note="Helical"
72-79 TOPO_DOM /note="Virion surface"
80-100 TRANSMEM /note="Helical"
101-222 TOPO_DOM /note="Intravirion"
1-219 DISORDER predicted by DISOPRED

MONOMER
222
pdb_id a1 identity[%]2 description
7vgr F 100.0 VME1_SARS2 Membrane protein 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
222 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7vgr[2] A YN7756_1 Fab light chain[218 aa] E 100.0
/100.0		 3
/3		 VME1_SARS2 Membrane protein
7vgr[2] C YN7756_1 Fab light chain[218 aa] E 100.0
/100.0		 4
/4		 VME1_SARS2 Membrane protein
7vgr[2] B YN7756_1 Fab heavy chain[220 aa] E 100.0
/100.0		 9
/9		 VME1_SARS2 Membrane protein
7vgr[2] D YN7756_1 Fab heavy chain[220 aa] E 100.0
/100.0		 4
/4		 VME1_SARS2 Membrane protein
7vgs[2] B YN7717_9 Fab light chain[218 aa] A 100.0
/100.0		 9
/9		 VME1_SARS2 Membrane protein
7vgs[2] E YN7717_9 Fab light chain[218 aa] A 100.0
/100.0		 3
/3		 VME1_SARS2 Membrane protein
7vgs[2] C YN7717_9 Fab heavy chain[213 aa] A 100.0
/100.0		 9
/9		 VME1_SARS2 Membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
222 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7y9b[4] E N8E
3,6,9,12,15-PENTAOXATRICOSAN-1-OL[24 atoms] 		A 25.0
/46.2		 4
/4		 VME1_BCHK5 Membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
222 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7vgr[4] F VME1_SARS2 Membrane protein[198 aa] E 100.0
/100.0		 46
/46		 VME1_SARS2 Membrane protein
8ctk[2] B VME1_SARS2 Membrane protein[188 aa] A 100.0
/100.0		 36
/36		 VME1_SARS2 Membrane protein
7y9b[4] B VME1_BCHK5 Membrane protein[187 aa] A 45.6
/46.2		 57
/58		 VME1_BCHK5 Membrane protein
7y96[4] B GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. A 53.3
/44.0		 30
/38		 GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein
7y96[4] B GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. A 18.2
/44.0		 11
/11		 GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein
7y96[2] B GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. B 43.9
/44.2		 41
/41		 GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.