Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
885704 | 75 | 23 | P0DTC4(VEMP_SARS2) | RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
75 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-75 | CHAIN | /note="Envelope small membrane protein" /id="PRO_0000449651" |
![]() ![]() |
1-13 | TOPO_DOM | /note="Virion surface" ECO:0000305|PubMed:32898469" |
![]() ![]() ![]() |
14-34 | TRANSMEM | /note="Helical" ECO:0000269|PubMed:33177698, ECO:0000305|PubMed:32898469" |
![]() ![]() |
35-75 | TOPO_DOM | /note="Intravirion" ECO:0000305|PubMed:32898469" |
![]() ![]() |
61-75 | REGION | /note="Disordered" |
![]() |
|||||||
75 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 91.4 | VEMP_CVHSA Envelope small membrane protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
75 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | MPP5_HUMAN MPP5_HUMAN MAGUK p55 subfamily member 5[360 aa] | C | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() ![]() |
![]() |
A | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | C | 100.0 /100.0 |
6 /6 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() ![]() |
![]() |
A | PALS1_HUMAN Protein PALS1[97 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | AFAD_HUMAN Afadin[87 aa] | C | 100.0 /100.0 |
2 /2 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() |
![]() |
A | LNX2_HUMAN Ligand of Numb protein X 2[90 aa] | C | 100.0 /100.0 |
5 /5 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() ![]() |
![]() |
A | BRD4_HUMAN Bromodomain-containing protein 4[124 aa] | C | 66.7 /66.7 |
3 /3 |
VEMP_SARS2 Envelope small membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
75 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | VEMP_CVHSA Envelope small membrane protein[58 aa] | A | 100.0 /91.4 |
9 /9 |
VEMP_CVHSA Envelope small membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | VEMP_CVHSA Envelope small membrane protein[58 aa] | A | 100.0 /91.4 |
6 /6 |
VEMP_CVHSA Envelope small membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
75 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() |
![]() |
M |
EDO
|
E | 100.0 /100.0 |
1 /1 |
VEMP_SARS2 Envelope small membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |