[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
15155 1273 542 P0DTC2(SPIKE_SARS2) RecName: Full=Spike glycoprotein ; Short=S glycoprotein ;AltName: Full=E2 ;AltName: Full=Peplomer protein ;Contains: RecName: Full=Spike protein S1 ;Contains: RecName: Full=Spike protein S2 ;Contains: RecName: Full=Spike protein S2' ;Flags: Precursor;
QUERYSEQ
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNK
SWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN
YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECS
NLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLM
SFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0DTC2(SPIKE_SARS2)]

1273
region name description
1-12 SIGNAL
13-1273 CHAIN /note="Spike glycoprotein" /id="PRO_0000449646"
13-685 CHAIN /note="Spike protein S1" /id="PRO_0000449647"
686-1273 CHAIN /note="Spike protein S2" /id="PRO_0000449648"
816-1273 CHAIN /note="Spike protein S2'" /id="PRO_0000449649"
13-1213 TOPO_DOM /note="Extracellular"
1214-1234 TRANSMEM /note="Helical"
1235-1273 TOPO_DOM /note="Cytoplasmic"
13-303 DOMAIN /note="BetaCoV S1-NTD"
334-527 DOMAIN /note="BetaCoV S1-CTD" ECO:0000269|PubMed:32132184"
319-541 REGION /note="Receptor-binding domain (RBD)" ECO:0000269|PubMed:32132184"
437-508 REGION /note="Receptor-binding motif; binding to human ACE2"
816-837 REGION /note="Fusion peptide 1"
835-855 REGION /note="Fusion peptide 2"
920-970 REGION /note="Heptad repeat 1"
1163-1202 REGION /note="Heptad repeat 2"
949-993 COILED
1176-1203 COILED
1-1273 DISORDER predicted by DISOPRED (1-26,679-687,1021-1021,1024-1024,1271-1273)

MONOMER
1273
pdb_id a1 identity[%]2 description
7jjj A 99.8 SPIKE_SARS2 Spike glycoprotein
6xr8 A 100.0 SPIKE_SARS2 Spike glycoprotein
6xra A 100.0 SPIKE_SARS2 Spike glycoprotein
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xkq[1] C CV07-250 Light Chain[212 aa] A 100.0
/100.0
12
/12
SPIKE_SARS2 Spike protein S1
7cws[3] J Light Chain of FC05 Fab[109 aa] M 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7cwu[3] B light chain of FC05 Fab[109 aa] H 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xdg[1] C REGN10933 antibody Fab fragment heavy chain[212 aa.. A 100.0
/100.0
11
/11
SPIKE_SARS2 Spike glycoprotein
6xdg[1] D REGN10987 antibody Fab fragment heavy chain[212 aa.. A 100.0
/100.0
9
/9
SPIKE_SARS2 Spike glycoprotein
7bwj[1] B antibody light chain[213 aa] A 100.0
/100.0
3
/3
SPIKE_SARS2 SARS-CoV-2 receptor binding domain
7bwj[1] C antibody heavy chain[229 aa] A 100.0
/100.0
11
/11
SPIKE_SARS2 SARS-CoV-2 receptor binding domain
7c8v[1] A Synthetic nanobody SR4[119 aa] B 100.0
/100.0
20
/20
SPIKE_SARS2 Spike glycoprotein
7a5r[2] B CR3022 Fab Light Chain[202 aa] C 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
6xdg[1] B REGN10933 antibody Fab fragment light chain[214 aa.. A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7jx3[1] B Heavy chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
13
/13
SPIKE_SARS2 Spike glycoprotein
7k9z[1] D 298 Fab Heavy Chain[218 aa] E 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
7jmp[1] B COVA2-39 heavy chain[218 aa] A 100.0
/100.0
11
/11
SPIKE_SARS2 Spike protein S1
7chf[18] B BD-604 Fab light chain[211 aa] C 100.0
/100.0
12
/12
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
7jx3[9] E Light chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
13
/13
SPIKE_SARS2 Spike glycoprotein
7k9z[1] B 52 Fab Light Chain[212 aa] E 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
7jw0[3] B S304 Fab light chain[212 aa] A 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zcz[1] D EY6A light chain[215 aa] A 100.0
/100.0
13
/13
SPIKE_SARS2 Spike glycoprotein
7cdj[2] C antibody P2C-1A3 light chain[213 aa] A 100.0
/100.0
7
/7
SPIKE_SARS2 Spike protein S1
6zdh[3] E EY6A light chain[215 aa] A 100.0
/99.8
10
/10
SPIKE_SARS2 Spike glycoprotein
6zdg[3] F EY6A light chain[215 aa] G 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7jvb[2] D Nanobody Nb20[117 aa] C 100.0
/100.0
12
/12
SPIKE_SARS2 Spike glycoprotein
7kfv[8] F Heavy chain of antibody C1A-B12 Fab[219 aa] E 100.0
/100.0
19
/19
A0A6N1WIU8_SARS2 Surface glycoprotein
6m17[2] B ACE2_HUMAN Angiotensin-converting enzyme 2[748 aa] C 100.0
/100.0
16
/16
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
7jjc[4] A NRP1_HUMAN Neuropilin-1[159 aa] E 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7cak[6] F Light chain of H014 Fab[107 aa] B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cws[3] G Light Chain of H014 Fab[107 aa] M 100.0
/100.0
8
/8
SPIKE_SARS2 Spike glycoprotein
7cah[1] A Light chain of H014 Fab[105 aa] C 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6xc4[5] B CC12.3 heavy chain[220 aa] A 100.0
/100.0
18
/18
SPIKE_SARS2 Spike protein S1
7k9z[1] A 52 Fab Heavy Chain[212 aa] E 100.0
/100.0
14
/14
SPIKE_SARS2 Spike glycoprotein
7c8w[2] A Synthetic nanobody MR17[120 aa] B 100.0
/100.0
18
/18
SPIKE_SARS2 Spike glycoprotein
7che[3] D BD-368-2 Fab heavy chain[219 aa] C 100.0
/100.0
10
/10
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
7jmo[11] B COVA2-04 heavy chain[216 aa] A 100.0
/100.0
20
/20
SPIKE_SARS2 Spike protein S1
6zer[9] H heavy chain[220 aa] G 100.0
/100.0
11
/11
SPIKE_SARS2 RBD
6zdh[3] D EY6A heavy chain[219 aa] A 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
6zdh[3] D EY6A heavy chain[219 aa] C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zdg[1] B EY6A heavy chain[219 aa] D 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7jzl[1] F LCB1[55 aa] E 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7jzl[2] B LCB1[55 aa] A 100.0
/99.4
6
/6
SPIKE_SARS2 Spike glycoprotein
7jzl[1] D LCB1[55 aa] C 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7jva[1] A S2A4 Fab heavy chain[117 aa] C 100.0
/100.0
8
/8
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k4n[4] B S2E12 neutralizing antibody Fab fragment (heavy ch.. A 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
6zhd[6] E Nanobody H11-H4[128 aa] C 100.0
/99.8
14
/14
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zbp[7] B H11-H4[128 aa] A 100.0
/100.0
14
/14
SPIKE_SARS2 Spike glycoprotein
6zhd[1] F Nanobody H11-H4[128 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 WAC_BPT4 Spike glycoprotein,Fibritin
6zcz[1] B Nanobody[125 aa] A 100.0
/100.0
15
/15
SPIKE_SARS2 Spike glycoprotein
7jva[1] B S2A4 Fab light chain[110 aa] C 100.0
/100.0
11
/11
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7cwu[3] C heavy chain of FC05 Fab[120 aa] G 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7cws[3] I Heavy Chain of FC05 Fab[120 aa] M 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7jmw[1] B COVA1-16 heavy chain[230 aa] A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike protein S1
6xc4[8] F CC12.3 light chain[213 aa] D 100.0
/100.0
5
/5
SPIKE_SARS2 Spike protein S1
7jx3[1] A Light chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7cjf[1] A antibody heavy chain[220 aa] C 100.0
/100.0
20
/20
SPIKE_SARS2 Spike glycoprotein
6z2m[13] E CR3022 antibody[216 aa] D 100.0
/100.0
16
/16
SPIKE_SARS2 Spike glycoprotein
7a5r[4] A CR3022 Fab Heavy Chain[213 aa] D 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
7a5r[4] F CR3022 Fab Heavy Chain[213 aa] D 100.0
/100.0
12
/12
SPIKE_SARS2 Spike glycoprotein
6xkq[1] B CV07-250 Heavy Chain[222 aa] A 100.0
/100.0
9
/9
SPIKE_SARS2 Spike protein S1
6xkp[2] C CV07-270 Heavy Chain[220 aa] A 100.0
/100.0
18
/18
SPIKE_SARS2 Spike protein S1
7jx3[1] D Heavy chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
12
/12
SPIKE_SARS2 Spike glycoprotein
7cdj[1] B antibody P2C-1A3 heavy chain[212 aa] A 100.0
/100.0
14
/14
SPIKE_SARS2 Spike protein S1
6xkp[2] D CV07-270 Light Chain[211 aa] A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike protein S1
7jmp[1] C COVA2-39 light chain[211 aa] A 100.0
/100.0
2
/2
SPIKE_SARS2 Spike protein S1
7chc[3] E BD-368-2 Fab L[216 aa] C 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6yor[4] F IgG L chain[219 aa] D 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6ym0[3] C light chain[220 aa] A 100.0
/100.0
8
/8
SPIKE_SARS2 Spike glycoprotein
6zh9[3] B CR3022 Light chain[219 aa] C 100.0
/100.0
8
/8
SPIKE_SARS2 Spike glycoprotein
6xc3[3] B CR3022 light chain[221 aa] E 100.0
/100.0
4
/4
SPIKE_SARS2 Spike protein S1
7a5s[2] B CR3022 Fab Light Chain[218 aa] C 100.0
/100.0
10
/10
SPIKE_SARS2 Spike glycoprotein
7k9z[1] C 298 Fab Light Chain[220 aa] E 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
7c8d[1] A ACE2_FELCA Angiotensin-converting enzyme 2[597 aa] B 100.0
/100.0
18
/18
SPIKE_SARS2 Spike protein S1
7cwn[10] L heavy chain of P17 Fab[120 aa] A 100.0
/100.0
11
/11
SPIKE_SARS2 Spike glycoprotein
7c01[2] E CB6 heavy chain[218 aa] D 100.0
/100.0
19
/19
SPIKE_SARS2 SARS-Cov-2 Spike protein S1
7dcx[9] D The heavy chain of 3C1 fab that binds with the up .. H 100.0
/99.8
22
/22
SPIKE_SARS2 SARS-Cov2 S protein
7dcx[1] B The heavy chain of 3C1 fab that binds with the up .. I 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-Cov2 S protein
7dcx[2] G The light chain of 3C1 fab[213 aa] C 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-Cov2 S protein
7dcc[9] E The light chain of 3C1 fab[213 aa] H 100.0
/99.8
19
/19
SPIKE_SARS2 SARC-CoV2 S protein
7dcx[1] F The light chain of 3C1 fab[180 aa] I 100.0
/99.8
17
/17
SPIKE_SARS2 SARS-Cov2 S protein
7dd2[1] D The light chain of 3C1 fab[213 aa] B 100.0
/99.8
7
/7
SPIKE_SARS2 SARS-Cov2-S protein
7dk7[8] G The heavy chain fragment of 2H2 Fab[214 aa] D 100.0
/99.8
14
/14
SPIKE_SARS2 SARS-CoV-2 S protein
7dk7[8] F The light chain fragment of 2H2 Fab[218 aa] C 100.0
/99.8
13
/13
SPIKE_SARS2 SARS-CoV-2 S protein
7dk4[1] I The light chain of 2H2 Fab[218 aa] D 100.0
/99.8
10
/10
SPIKE_SARS2 SARS-CoV-2 S protein
7dk7[1] A The heavy chain fragment of 2H2 Fab[18 aa] I 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 S protein
7dk7[1] B The light chain fragment of 2H2 Fab[119 aa] I 100.0
/99.8
8
/8
SPIKE_SARS2 SARS-CoV-2 S protein
7a29[6] D Neutralising sybody (Sb23)[114 aa] A 100.0
/99.8
9
/9
SPIKE_SARS2 Spike glycoprotein
7a29[1] F Neutralising sybody (Sb23)[114 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7c2l[3] H heavy chain of 4A8[229 aa] C 100.0
/99.8
11
/11
Spike glycoprotein
6zxn[3] E Nanobody Ty1[118 aa] B 100.0
/99.8
18
/18
SPIKE_SARS2 Spike glycoprotein
6zxn[1] F Nanobody Ty1[118 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k43[3] F S2M11 Fab fragment (light chain)[105 aa] D 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k43[3] C S2M11 Fab fragment (light chain)[105 aa] D 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k43[3] B S2M11 Fab fragment (heavy chain)[122 aa] A 100.0
/99.8
14
/14
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k43[3] B S2M11 Fab fragment (heavy chain)[122 aa] D 100.0
/99.8
7
/7
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xey[3] G 2-4 Heavy Chain[122 aa] C 100.0
/99.8
13
/13
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6ack[10] D ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] C 53.8
/76.7
13
/13
SPIKE_CVHSA Spike glycoprotein
7a91[10] A ACE2_HUMAN Angiotensin-converting enzyme 2[588 aa] B 100.0
/100.0
15
/15
SPIKE_SARS2 Spike glycoprotein
7ct5[16] D ACE2_HUMAN Angiotensin-converting enzyme 2[595 aa] A 100.0
/99.8
18
/18
SPIKE_SARS2 Spike glycoprotein
6cs2[1] D ACE2_HUMAN Angiotensin-converting enzyme 2[544 aa] B 42.1
/76.3
19
/19
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6m0j[2] A ACE2_HUMAN Angiotensin-converting enzyme 2[597 aa] B 100.0
/100.0
17
/17
SPIKE_SARS2 Spike receptor binding domain
7cwn[6] G heavy chain of H014 Fab[122 aa] B 100.0
/100.0
16
/16
SPIKE_SARS2 Spike glycoprotein
7cws[3] D Heavy Chain of H014 Fab[122 aa] N 100.0
/100.0
17
/17
SPIKE_SARS2 Spike glycoprotein
7cah[1] B Heavy chain of H014 Fab[120 aa] C 100.0
/100.0
13
/13
SPIKE_SARS2 Spike glycoprotein
7cai[1] G Heavy chain of H014 Fab[214 aa] C 100.0
/99.8
8
/8
SPIKE_SARS2 Spike glycoprotein
7cai[2] E Heavy chain of H014 Fab[214 aa] A 100.0
/99.8
17
/17
SPIKE_SARS2 Spike glycoprotein
7cai[2] D Light chain of H014 Fab[207 aa] A 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
7jw0[3] I S304 Fab heavy chain[219 aa] G 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jx3[1] F Heavy chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
13
/13
SPIKE_SARS2 Spike glycoprotein
7kkk[6] D Synthetic nanobody Nb6[118 aa] C 100.0
/99.8
16
/16
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7kkl[6] D Synthetic nanobody mNb6[118 aa] E 100.0
/99.8
7
/7
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k8y[2] E C121 Fab Light chain[108 aa] B 100.0
/99.8
6
/6
SPIKE_SARS2 Spike glycoprotein
7k8x[2] G C121 Fab Light chain[108 aa] A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8x[1] E C121 Fab Heavy chain[128 aa] B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7k8y[3] D C121 Fab Heavy chain[128 aa] A 100.0
/99.8
11
/11
SPIKE_SARS2 Spike glycoprotein
7k8t[2] H C002 Fab Heavy Chain[125 aa] C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8s[6] D C002 Fab Heavy Chain[125 aa] A 100.0
/99.8
13
/13
SPIKE_SARS2 Spike glycoprotein
7cwn[16] M light chain of P17 Fab[107 aa] A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7k8s[3] E C002 Fab Light Chain[107 aa] C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7cwm[2] G P17 light chain[108 aa] B 100.0
/100.0
6
/6
SPIKE_SARS2 Spike glycoprotein
7byr[1] D Ab23-Fab-Heavy Chain[102 aa] B 100.0
/99.8
14
/14
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
7jwb[3] A autonomous human heavy chain variable domain[366 a.. D 100.0
/99.8
14
/14
SPIKE_SARS2 Spike glycoprotein
7jx3[1] C Light chain of Fab domain of monoclonal antibody S.. G 100.0
/100.0
9
/9
SPIKE_SARS2 Spike glycoprotein
7jvc[3] C S2A4 Fab light chain[214 aa] A 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jvc[3] E S2A4 Fab heavy chain[220 aa] D 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jv6[7] I S2H13 Fab light chain[109 aa] G 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jv4[1] E S2H13 Fab light chain[109 aa] B 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jv6[7] B S2H13 Fab heavy chain[118 aa] A 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6wpt[4] E S309 neutralizing antibody light chain[99 aa] C 100.0
/99.8
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6wps[5] H S309 neutralizing antibody heavy chain[123 aa] G 100.0
/99.8
13
/13
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k8u[1] D C104 Fab Heavy Chain[106 aa] A 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7k8w[1] E C119 Fab Light Chain[111 aa] B 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8w[2] E C119 Fab Light Chain[111 aa] A 100.0
/99.7
5
/5
SPIKE_SARS2 Spike glycoprotein
7k8w[1] F C119 Fab Heavy Chain[126 aa] A 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8w[2] F C119 Fab Heavy Chain[126 aa] C 100.0
/99.7
8
/8
SPIKE_SARS2 Spike glycoprotein
7k8u[1] E C104 Fab Light Chain[107 aa] A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7k8u[1] E C104 Fab Light Chain[107 aa] B 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcn[5] H C105 Fab Light Chain[111 aa] C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6xey[3] I A0A5C2GJG2_HUMAN 2-4 Light Chain[108 aa] A 100.0
/99.8
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xcm[5] E C105 Fab Heavy Chain[116 aa] B 100.0
/99.7
13
/13
SPIKE_SARS2 Spike glycoprotein
7k8v[2] F C110 Fab Heavy Chain[126 aa] C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7k8z[4] E C135 Fab Light Chain[106 aa] A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7k8z[2] D C135 Fab Heavy Chain[118 aa] A 100.0
/99.7
6
/6
SPIKE_SARS2 Spike glycoprotein
7chh[3] G BD-368-2 Fab light chain[112 aa] B 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7k90[3] I C144 Fab Light Chain[108 aa] C 100.0
/99.4
1
/1
SPIKE_SARS2 Spike glycoprotein
7k90[3] E C144 Fab Heavy Chain[129 aa] A 100.0
/99.4
12
/12
SPIKE_SARS2 Spike glycoprotein
7k90[3] E C144 Fab Heavy Chain[129 aa] B 100.0
/99.4
7
/7
SPIKE_SARS2 Spike glycoprotein
7chh[3] F BD-368-2 Fab heavy chain[124 aa] B 100.0
/99.4
9
/9
SPIKE_SARS2 Spike glycoprotein
7k4n[4] C S2E12 neutralizing antibody Fab fragment (light ch.. A 100.0
/99.4
3
/3
SPIKE_SARS2 Spike glycoprotein
7kl9[3] E CTC-445.2 inhibitor[160 aa] C 100.0
/99.4
15
/15
SPIKE_SARS2 Spike glycoprotein
7kl9[1] D CTC-445.2 inhibitor[160 aa] C 100.0
/99.4
6
/6
SPIKE_SARS2 Spike glycoprotein
7jzn[4] B LCB3[64 aa] A 100.0
/99.5
7
/7
SPIKE_SARS2 Spike glycoprotein
7jzn[1] B LCB3[64 aa] C 100.0
/99.4
2
/2
SPIKE_SARS2 Spike glycoprotein
6nb7[5] E S230 light chain[110 aa] B 0.0
/78.4
3
/3
SPIKE_CVHSA Spike glycoprotein
6nb6[1] E S230 heavy chain[124 aa] B 100.0
/78.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb6[1] D S230 heavy chain[123 aa] C 100.0
/77.7
1
/1
SPIKE_CVHSA Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6yla[1] X PG0
2-(2-METHOXYETHOXY)ETHANOL[8 atoms]
D 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
7jji[2] BB VCG
2-hydroxyethyl 2-deoxy-3,5-bis-O-(2-hydroxyethyl)-..
B 100.0
/99.8
15
/15
SPIKE_SARS2 Spike glycoprotein
7dk3[1] EL PRO
PROLINE[7 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] JK PRO
PROLINE[7 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] ML PRO
PROLINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RG PRO
PROLINE[7 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BJ PRO
PROLINE[7 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] WG PRO
PROLINE[7 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] TA HIS
HISTIDINE[10 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6nb6[181] FB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/77.7
2
/2
SPIKE_CVHSA Spike glycoprotein
7knh[568] UA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6vyb[30] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7kdh[788] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8s[159] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[8] ZA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7knh[53] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zdh[17] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jvc[532] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zoy[242] SA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.6
5
/5
SPIKE_SARS2 Spike glycoprotein
7k8s[171] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6wpt[35] AB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6xm4[58] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6x79[54] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.6
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7byr[50] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6xm3[35] OA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
5x58[5] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/76.5
1
/1
Spike glycoprotein
7byr[80] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6cs2[16] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/77.0
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zox[18] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zoy[23] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.6
3
/3
SPIKE_SARS2 Spike glycoprotein
5x58[40] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/76.5
3
/3
Spike glycoprotein
6m3w[4] P NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 50.0
/91.6
2
/2
SPIKE_CVHSA Spike glycoprotein
6zp0[16] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6zgf[7] AB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zge[8] MA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zge[18] WA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
5x58[3] E NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/76.5
2
/2
Spike glycoprotein
7jw0[11] FB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
G 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6vyb[45] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6vxx[30] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7df3[11] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7kms[4] PA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zge[11] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7kmz[83] Y NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zfo[7] H NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7a94[3] F NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zp0[18] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7kj2[14] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp1[11] QA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7a94[3] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6m3w[3] R NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/91.6
1
/1
SPIKE_CVHSA Spike glycoprotein
6zgf[3] GB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6wps[6] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
D 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
5x58[6] J NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/76.5
2
/2
Spike glycoprotein
6xra[3] DA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
5x58[6] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/76.5
3
/3
Spike glycoprotein
6crv[3] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/76.8
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7kj5[8] CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7k8t[1] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
5x58[3] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/76.5
1
/1
Spike glycoprotein
6vyb[30] X NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6zgi[5] LA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6xf5[6] TA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jw0[30] BA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zox[15] WA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7jv4[5] IA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6m3w[3] K NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/91.6
2
/2
SPIKE_CVHSA Spike glycoprotein
6zp2[18] U NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7kj3[7] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6nb6[1] YA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6m3w[3] D NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/91.6
1
/1
SPIKE_CVHSA Spike glycoprotein
7cn9[2] CA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike protein S1, Spike protein S2
6nb6[4] DB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/78.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb7[6] CB NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/78.4
1
/1
SPIKE_CVHSA Spike glycoprotein
6m3w[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/91.6
1
/1
SPIKE_CVHSA Spike glycoprotein
5x58[4] W NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 100.0
/76.5
3
/3
Spike glycoprotein
5x58[3] IA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 50.0
/76.5
2
/2
Spike glycoprotein
6x6p[3] Q NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zgf[3] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6x79[4] V NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.6
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k8t[1] VA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
5x58[3] GA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 0.0
/76.5
1
/1
Spike glycoprotein
5x58[3] NA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
B 0.0
/76.5
1
/1
Spike glycoprotein
5x58[3] AA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 50.0
/76.5
4
/4
Spike glycoprotein
6xf5[1] EA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6xlu[1] JA NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..
C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] YK GLN
GLUTAMINE[9 atoms]
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] YK GLN
GLUTAMINE[9 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] DL GLN
GLUTAMINE[9 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] YN ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] WK ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
5
/5
SPIKE_SARS2 Spike glycoprotein
7dk3[1] QN ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
6
/6
SPIKE_SARS2 Spike glycoprotein
7dk3[1] IL ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
6
/6
SPIKE_SARS2 Spike glycoprotein
7dk3[1] FQ ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] EO ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] XG ILE
ISOLEUCINE[8 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] TO ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] NM ILE
ISOLEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[3] XL VAL
VALINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] JN VAL
VALINE[7 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[2] GM VAL
VALINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] JL VAL
VALINE[7 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RA VAL
VALINE[7 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] CL VAL
VALINE[7 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RM VAL
VALINE[7 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] EP VAL
VALINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] MA VAL
VALINE[7 atoms]
B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] SK VAL
VALINE[7 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] DP LYS
LYSINE[9 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] VI LYS
LYSINE[9 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] DJ LYS
LYSINE[9 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] LA LYS
LYSINE[9 atoms]
B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] UK LYS
LYSINE[9 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] VO TRP
TRYPTOPHAN[14 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[2] NK THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BM THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] HN THR
THREONINE[7 atoms]
C 100.0
/99.7
7
/7
SPIKE_SARS2 Spike glycoprotein
7dk3[1] J THR
THREONINE[7 atoms]
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] FL THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] UE THR
THREONINE[7 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] PO THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RK THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] DQ THR
THREONINE[7 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] UI PHE
PHENYLALANINE[11 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[2] OO PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] VE PHE
PHENYLALANINE[11 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] NA PHE
PHENYLALANINE[11 atoms]
B 100.0
/99.8
6
/6
SPIKE_SARS2 Spike glycoprotein
7dk3[2] ON PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] YL PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] PP PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BL PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
5
/5
SPIKE_SARS2 Spike glycoprotein
7dk3[1] GN PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
5
/5
SPIKE_SARS2 Spike glycoprotein
7dk3[1] LL PHE
PHENYLALANINE[11 atoms]
C 100.0
/99.7
6
/6
SPIKE_SARS2 Spike glycoprotein
7dk3[1] UN GLU
GLUTAMIC ACID[9 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] TK GLU
GLUTAMIC ACID[9 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] QG GLU
GLUTAMIC ACID[9 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] GL GLU
GLUTAMIC ACID[9 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] EQ GLU
GLUTAMIC ACID[9 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] LP LEU
LEUCINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] OP LEU
LEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] KK LEU
LEUCINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BN LEU
LEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] EN LEU
LEUCINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] AP LEU
LEUCINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] NP ARG
ARGININE[11 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] OA ARG
ARGININE[11 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RN ARG
ARGININE[11 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] CM ARG
ARGININE[11 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] KL ARG
ARGININE[11 atoms]
C 100.0
/99.7
11
/11
SPIKE_SARS2 Spike glycoprotein
7dk3[1] N ARG
ARGININE[11 atoms]
A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] N ARG
ARGININE[11 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] KA ASP
ASPARTIC ACID[8 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BP ASP
ASPARTIC ACID[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] TN ASP
ASPARTIC ACID[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] TM ASP
ASPARTIC ACID[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] MN ASP
ASPARTIC ACID[8 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] PM ASN
ASPARAGINE[8 atoms]
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] PM ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] NL ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] KI ASN
ASPARAGINE[8 atoms]
B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[2] WO ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] M ASN
ASPARAGINE[8 atoms]
A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] M ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] HP ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] CN ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] IN ASN
ASPARAGINE[8 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] BG TYR
TYROSINE[12 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] XK TYR
TYROSINE[12 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[4] HM TYR
TYROSINE[12 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] PI TYR
TYROSINE[12 atoms]
B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[3] JO TYR
TYROSINE[12 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] IA TYR
TYROSINE[12 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6zcz[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xra[6] K alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xra[3] P alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xra[3] J alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7c8w[1] C alpha-L-fucopyranose-(1-3)-[2-acetamido-2-deoxy-be.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xr8[3] HA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6xr8[3] W alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] X alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] X alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6xra[3] L alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xr8[3] BA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xr8[3] V alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xr8[3] LA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6xr8[3] KA alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. C 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6xr8[3] G alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. A 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6x6p[425] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7a25[46] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
7
/7
SPIKE_SARS2 Spike glycoprotein
6xm4[3] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zb4[157] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6zp1[212] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[9] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zox[13] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6xcm[22] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6xm3[32] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7c2l[157] AA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
3
/3
Spike glycoprotein
7k4n[30] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.4
4
/4
SPIKE_SARS2 Spike glycoprotein
6zgi[6] V 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zp5[6] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7kdi[63] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.9
1
/1
SPIKE_SARS2 Spike glycoprotein
6crx[5] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 80.0
/76.2
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7jwy[8] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7df3[93] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7jvc[32] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/99.8
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6crv[12] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 75.0
/76.8
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zgi[9] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[9] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7a5s[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
6crw[5] J 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 50.0
/76.2
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zow[6] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[12] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7jjj[24] FA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
7jjj[9] GA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6xra[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7jw0[6] X 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6crx[9] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 0.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zdh[18] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[11] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/97.4
5
/5
A0A6B9WHD3_CVHSA Spike glycoprotein
6zge[11] EA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7df3[17] Q 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
7jv6[26] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6crw[4] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/76.3
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7kj5[12] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[3] W 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zge[6] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6zgf[3] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgf[15] X 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6nb6[1] U 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/78.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6crw[6] M 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/76.2
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zgf[3] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
7jmw[3] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike protein S1
6zgi[6] AA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6vxx[4] I 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7jji[7] IA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7k43[3] Y 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. G 100.0
/99.8
4
/4
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zgf[9] O 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/97.4
4
/4
A0A6B9WHD3_CVHSA Spike glycoprotein
6xey[3] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6nb7[1] KA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/78.1
1
/1
SPIKE_CVHSA Spike glycoprotein
7kmb[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7cn9[1] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike protein S1, Spike protein S2
6nb7[1] KA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 0.0
/77.8
1
/1
SPIKE_CVHSA Spike glycoprotein
6xra[3] H 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6crx[2] BA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/76.2
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6xm4[2] P 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6crx[1] L 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6xr8[3] DA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6xcn[5] S 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7can[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7jjj[2] GB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. D 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[3] R 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/97.4
2
/2
A0A6B9WHD3_CVHSA Spike glycoprotein
7jjj[2] GB 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. F 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7cn9[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike protein S1, Spike protein S2
7jzm[2] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6m17[2] N 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0
1
/1
SPIKE_SARS2 SARS-coV-2 Receptor Binding Domain
7c2l[3] T 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/99.8
2
/2
Spike glycoprotein
7c2l[3] CA 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/99.8
3
/3
Spike glycoprotein
6xey[2] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6cs0[3] S alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. C 75.0
/76.3
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] U alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/76.3
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6xdg[1] F alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7cn9[1] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike protein S1, Spike protein S2
6nb6[2] DA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 60.0
/78.3
5
/5
SPIKE_CVHSA Spike glycoprotein
6nb7[1] GA alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/78.4
2
/2
SPIKE_CVHSA Spike glycoprotein
7cn9[1] L alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike protein S1, Spike protein S2
6wps[4] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. D 100.0
/99.8
5
/5
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k8z[1] N alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6zp5[3] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6cs1[4] Q beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 85.7
/76.3
7
/7
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[6] LA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/77.7
3
/3
SPIKE_CVHSA Spike glycoprotein
6nb7[5] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/77.8
1
/1
SPIKE_CVHSA Spike glycoprotein
6nb6[4] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6zow[6] CA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6cs1[8] V beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 80.0
/76.3
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[2] J beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 0.0
/78.3
1
/1
SPIKE_CVHSA Spike glycoprotein
6cs2[6] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 33.3
/77.1
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7cn9[1] G beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike protein S1, Spike protein S2
6crx[8] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 0.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zow[3] BA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
6xcn[12] L beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
6zow[3] BA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6zgf[3] I beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6nb7[5] LA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 50.0
/78.1
4
/4
SPIKE_CVHSA Spike glycoprotein
6nb7[5] AA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/77.8
2
/2
SPIKE_CVHSA Spike glycoprotein
6zp5[3] N beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6cs2[1] V beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[11] O beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs0[4] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crz[9] M beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 75.0
/76.2
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7jva[7] D beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/100.0
5
/5
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6nb6[1] IA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 50.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb6[6] Y beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/78.3
3
/3
SPIKE_CVHSA Spike glycoprotein
6xc7[1] F beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike protein S1
6nb6[6] FA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 50.0
/77.7
2
/2
SPIKE_CVHSA Spike glycoprotein
6zow[10] P beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7byr[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/99.8
1
/1
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6nb6[2] Z beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. B 100.0
/78.3
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb7[2] JA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 50.0
/78.1
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb7[2] TA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/78.1
2
/2
SPIKE_CVHSA Spike glycoprotein
6cs0[4] R beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/76.3
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] W beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 50.0
/77.0
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7byr[1] K beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
2
/2
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6nb6[1] HA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 50.0
/77.7
2
/2
SPIKE_CVHSA Spike glycoprotein
7cn9[1] P beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. A 100.0
/99.8
5
/5
SPIKE_SARS2 Spike protein S1, Spike protein S2
7jjj[2] HC beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7jjj[2] TA beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
7k43[4] S beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. D 100.0
/99.8
3
/3
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7k8z[1] V beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
6zgf[3] GA alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. C 100.0
/97.4
1
/1
A0A6B9WHD3_CVHSA Spike glycoprotein
6zgf[3] W alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 66.7
/97.4
3
/3
A0A6B9WHD3_CVHSA Spike glycoprotein
6xcm[1] J alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-bet.. A 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
6nb7[2] T alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 75.0
/77.8
4
/4
SPIKE_CVHSA Spike glycoprotein
6cs0[8] E alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/76.3
3
/3
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[2] K alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 80.0
/77.1
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crx[8] X alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/76.2
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zow[6] S alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6zp7[3] U alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/99.8
1
/1
SPIKE_SARS2 Spike glycoprotein
6crx[8] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 80.0
/76.2
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] P alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 50.0
/76.3
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6zp7[3] F alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.8
3
/3
SPIKE_SARS2 Spike glycoprotein
6cs2[1] L alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/77.1
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crx[5] O alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. B 50.0
/76.3
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crw[1] R alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 60.0
/76.2
5
/5
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
7cn9[1] O alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. A 100.0
/99.8
2
/2
SPIKE_SARS2 Spike protein S1, Spike protein S2
6nb6[6] BA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 75.0
/78.3
4
/4
SPIKE_CVHSA Spike glycoprotein
6cs1[1] G alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 75.0
/76.2
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6nb6[2] P alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 75.0
/77.9
4
/4
SPIKE_CVHSA Spike glycoprotein
6nb7[3] U alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/77.8
2
/2
SPIKE_CVHSA Spike glycoprotein
6nb6[2] RA alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 75.0
/77.7
4
/4
SPIKE_CVHSA Spike glycoprotein
6nb6[2] M alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 100.0
/77.9
2
/2
SPIKE_CVHSA Spike glycoprotein
6cs1[1] H alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. A 75.0
/76.2
4
/4
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs1[1] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. B 0.0
/76.3
1
/1
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs1[1] S alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose.. C 100.0
/76.3
2
/2
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xra[6] A SPIKE_SARS2 Spike glycoprotein[348 aa] B 100.0
/100.0
120
/120
SPIKE_SARS2 Spike glycoprotein
6lvn[12] B SPIKE_SARS2 Spike protein S2[35 aa] A 100.0
/100.0
11
/11
SPIKE_SARS2 Spike protein S2
7kdk[247] B SPIKE_SARS2 Spike glycoprotein[972 aa] C 100.0
/99.9
96
/96
SPIKE_SARS2 Spike glycoprotein
6zgi[32] B SPIKE_SARS2 Spike glycoprotein[1098 aa] C 100.0
/99.8
94
/94
SPIKE_SARS2 Spike glycoprotein
7k43[30] D SPIKE_SARS2 SARS-CoV-2 spike glycoprotein[1034 aa] G 100.0
/99.8
86
/86
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
7cws[74] O SPIKE_SARS2 Spike glycoprotein[1076 aa] M 100.0
/100.0
78
/78
SPIKE_SARS2 Spike glycoprotein
6zp1[74] A SPIKE_SARS2 Spike glycoprotein[1017 aa] C 98.6
/99.8
72
/72
SPIKE_SARS2 Spike glycoprotein
7cab[247] B SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein[1029 aa] A 98.3
/99.2
115
/115
SPIKE_SARS2 SARS-CoV-2 Spike glycoprotein
6zgh[32] B PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. A 100.0
/99.8
74
/74
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
7jv6[30] G SPIKE_SARS2 SARS-CoV-2 spike glycoprotein[977 aa] A 100.0
/99.8
93
/93
SPIKE_SARS2 SARS-CoV-2 spike glycoprotein
6zow[1] C SPIKE_SARS2 Spike glycoprotein[930 aa] D 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7jjj[2] F SPIKE_SARS2 Spike glycoprotein[1108 aa] A 100.0
/99.8
9
/9
SPIKE_SARS2 Spike glycoprotein
7jjj[2] A SPIKE_SARS2 Spike glycoprotein[1120 aa] F 100.0
/99.8
12
/12
SPIKE_SARS2 Spike glycoprotein
6zgh[1] A PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. C 100.0
/99.8
82
/82
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
6zgh[1] A PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike.. B 100.0
/99.8
72
/72
PTPRS_CHICK SPIKE_SARS2 WAC_BPT4 Receptor-type tyrosine-protein phosphatase S,Spike..
7dk3[1] C SPIKE_SARS2 Spike glycoprotein[602 aa] B 100.0
/99.8
77
/77
SPIKE_SARS2 Spike glycoprotein
7dk3[1] C SPIKE_SARS2 Spike glycoprotein[602 aa] A 100.0
/99.8
77
/77
SPIKE_SARS2 Spike glycoprotein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] B 100.0
/99.8
80
/80
SPIKE_SARS2 Spike glycoprotein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] D 100.0
/100.0
11
/11
SPIKE_SARS2 Spike glycoprotein
6zow[1] A SPIKE_SARS2 Spike glycoprotein[801 aa] C 100.0
/99.8
73
/73
SPIKE_SARS2 Spike glycoprotein
6zow[1] D SPIKE_SARS2 Spike glycoprotein[188 aa] C 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
6zow[1] D SPIKE_SARS2 Spike glycoprotein[188 aa] A 100.0
/99.8
4
/4
SPIKE_SARS2 Spike glycoprotein
7cn9[1] B SPIKE_SARS2 Spike protein S1, Spike protein S2[1010 aa] A 100.0
/99.8
63
/63
SPIKE_SARS2 Spike protein S1, Spike protein S2
7cn9[1] B SPIKE_SARS2 Spike protein S1, Spike protein S2[1010 aa] C 100.0
/99.7
63
/63
SPIKE_SARS2 Spike protein S1, Spike protein S2
6xs6[2] B SPIKE_SARS2 Spike glycoprotein[785 aa] A 100.0
/99.6
58
/58
SPIKE_SARS2 Spike glycoprotein
6xs6[2] A SPIKE_SARS2 Spike glycoprotein[785 aa] B 100.0
/99.6
55
/55
SPIKE_SARS2 Spike glycoprotein
6xs6[1] C SPIKE_SARS2 Spike glycoprotein[787 aa] A 100.0
/99.6
58
/58
SPIKE_SARS2 Spike glycoprotein
6xs6[1] C SPIKE_SARS2 Spike glycoprotein[787 aa] B 100.0
/99.6
53
/53
SPIKE_SARS2 Spike glycoprotein
6m3w[6] A SPIKE_CVHSA Spike glycoprotein[344 aa] B 95.6
/91.6
114
/114
SPIKE_CVHSA Spike glycoprotein
5wrg[3] B SPIKE_CVHSA Spike glycoprotein[736 aa] A 85.1
/81.9
47
/47
SPIKE_CVHSA Spike glycoprotein
5wrg[3] A SPIKE_CVHSA Spike glycoprotein[736 aa] B 94.0
/81.9
50
/50
SPIKE_CVHSA Spike glycoprotein
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] B 83.3
/76.3
72
/72
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] C SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[893 aa] A 91.9
/77.1
62
/62
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] B 90.6
/76.3
64
/64
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6cs2[1] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[891 aa] C 85.5
/77.0
69
/69
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] A SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] B 90.0
/76.8
70
/70
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
6crv[3] B SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin[881 aa] A 84.2
/76.8
76
/76
SPIKE_CVHSA D9IEJ2_BPT4 Spike glycoprotein,Fibritin
5x5b[22] A Spike glycoprotein[1033 aa] B 91.9
/76.5
74
/74
Spike glycoprotein
6acc[18] B SPIKE_CVHSA Spike glycoprotein[1065 aa] C 86.5
/76.7
96
/96
SPIKE_CVHSA Spike glycoprotein
5x58[22] C Spike glycoprotein[1052 aa] B 88.2
/76.5
110
/110
Spike glycoprotein
6nb7[6] C SPIKE_CVHSA Spike glycoprotein[1048 aa] A 91.5
/77.8
47
/47
SPIKE_CVHSA Spike glycoprotein
6acc[18] C SPIKE_CVHSA Spike glycoprotein[1065 aa] B 88.3
/76.7
94
/94
SPIKE_CVHSA Spike glycoprotein
6nb7[6] C SPIKE_CVHSA Spike glycoprotein[1048 aa] B 88.9
/78.4
45
/45
SPIKE_CVHSA Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
1273 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7c8w[2] D GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7c8v[1] D GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
7c8v[1] C GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
7c8v[1] J GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
7c8v[1] E GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7c8v[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
7c8v[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
7c8v[1] G GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7c8v[1] I GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6yla[1] I MLI
MALONATE ION[7 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[2] N MLI
MALONATE ION[7 atoms]
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[1] P EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6yz5[3] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6yz5[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[1] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6yz5[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6yz5[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6yz5[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
6yz5[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
SPIKE_SARS2 Spike glycoprotein
6yz5[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
SPIKE_SARS2 Spike glycoprotein
6yz5[1] O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[1] K DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6zow[3] BB DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
6zp7[3] LA DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/99.8
5
/5
SPIKE_SARS2 Spike glycoprotein
6yla[2] T DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[2] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
SPIKE_SARS2 Spike glycoprotein
6zow[3] YA DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6yla[1] J DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[2] Y DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yla[1] IA DMS
DIMETHYL SULFOXIDE[4 atoms]
D 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6xkp[1] M SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike protein S1
6xkp[2] O SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike protein S1
6xkp[2] P SO4
SULFATE ION[5 atoms]
B 100.0
/100.0
1
/1
SPIKE_SARS2 Spike protein S1
6yz5[1] K ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
3
/3
SPIKE_SARS2 Spike glycoprotein
6yz5[1] L ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7jvb[2] F CAC
CACODYLATE ION[5 atoms]
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
7jvb[2] E CAC
CACODYLATE ION[5 atoms]
A 100.0
/100.0
4
/4
SPIKE_SARS2 Spike glycoprotein
6zb5[9] W EIC
LINOLEIC ACID[20 atoms]
B 100.0
/100.0
9
/9
SPIKE_SARS2 Spike glycoprotein
6zb5[6] W EIC
LINOLEIC ACID[20 atoms]
C 100.0
/100.0
2
/2
SPIKE_SARS2 Spike glycoprotein
6zb5[2] M EIC
LINOLEIC ACID[20 atoms]
A 100.0
/100.0
1
/1
SPIKE_SARS2 Spike glycoprotein
6zp2[3] RA EIC
LINOLEIC ACID[20 atoms]
A 100.0
/99.8
15
/15
SPIKE_SARS2 Spike glycoprotein
6zp2[3] QA EIC
LINOLEIC ACID[20 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[2] QM CYS
CYSTEINE[6 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] RO CYS
CYSTEINE[6 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] WI CYS
CYSTEINE[6 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] CQ SER
SERINE[6 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] AJ SER
SERINE[6 atoms]
B 100.0
/99.8
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] XO SER
SERINE[6 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] NN SER
SERINE[6 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] AL SER
SERINE[6 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] OM SER
SERINE[6 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] CP SER
SERINE[6 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] HL SER
SERINE[6 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] SM ALA
ALANINE[5 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] LN ALA
ALANINE[5 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[2] AM ALA
ALANINE[5 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] VK GLY
GLYCINE[4 atoms]
C 100.0
/99.7
4
/4
SPIKE_SARS2 Spike glycoprotein
7dk3[1] GP GLY
GLYCINE[4 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
7dk3[1] SN GLY
GLYCINE[4 atoms]
C 100.0
/99.7
3
/3
SPIKE_SARS2 Spike glycoprotein
7dk3[1] QO GLY
GLYCINE[4 atoms]
C 100.0
/99.7
2
/2
SPIKE_SARS2 Spike glycoprotein
7dk3[1] FP GLY
GLYCINE[4 atoms]
C 100.0
/99.7
1
/1
SPIKE_SARS2 Spike glycoprotein
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.