Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4023246 7073 500 P0C6X7(R1AB_SARS) RecName: Full=Replicase polyprotein 1ab; Short=pp1ab;AltName: Full=ORF1ab polyprotein;Contains: RecName: Full=Host translation inhibitor nsp1; AltName: Full=Leader protein; AltName: Full=Non-structural protein 1; Short=nsp1;Contains: RecName: Full=Non-structural protein 2; Short=nsp2; AltName: Full=p65 homolog;Contains: RecName: Full=Papain-like protease nsp3; Short=PL-PRO; EC=3.4.19.12 ; EC=3.4.22.- ; AltName: Full=Non-structural protein 3; Short=nsp3; AltName: Full=PL2-PRO;Contains: RecName: Full=Non-structural protein 4; Short=nsp4;Contains: RecName: Full=3C-like proteinase nsp5; Short=3CL-PRO; Short=3CLp; EC=3.4.22.69 ; AltName: Full=Main protease; Short=Mpro; AltName: Full=Non-structural protein 5; Short=nsp5; AltName: Full=SARS coronavirus main proteinase;Contains: RecName: Full=Non-structural protein 6; Short=nsp6;Contains: RecName: Full=Non-structural protein 7; Short=nsp7;Contains: RecName: Full=Non-structural protein 8; Short=nsp8;Contains: RecName: Full=Viral protein genome-linked nsp9; AltName: Full=Non-structural protein 9; Short=nsp9; AltName: Full=RNA-capping enzyme subunit nsp9;Contains: RecName: Full=Non-structural protein 10; Short=nsp10; AltName: Full=Growth factor-like peptide; Short=GFL;Contains: RecName: Full=RNA-directed RNA polymerase nsp12; Short=Pol; Short=RdRp; EC=2.7.7.48; EC=2.7.7.50; AltName: Full=Non-structural protein 12; Short=nsp12;Contains: RecName: Full=Helicase nsp13; Short=Hel; EC=3.6.4.12 ; EC=3.6.4.13 ; AltName: Full=Non-structural protein 13; Short=nsp13;Contains: RecName: Full=Guanine-N7 methyltransferase nsp14 ; EC=2.1.1.-; EC=2.1.1.56 ; EC=3.1.13.-; AltName: Full=Non-structural protein 14; Short=nsp14; AltName: Full=Proofreading exoribonuclease nsp14 ; Short=ExoN;Contains: RecName: Full=Uridylate-specific endoribonuclease nsp15; EC=4.6.1.- ; AltName: Full=NendoU; AltName: Full=Non-structural protein 15; Short=nsp15;Contains: RecName: Full=2'-O-methyltransferase nsp16; EC=2.1.1.57 ; AltName: Full=Non-structural protein 16; Short=nsp16;
QUERYSEQ
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELG
TDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI
RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDL
LEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY
VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTV
LTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE
WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVA
GALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK
PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWN
LREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELG
VEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNN
CYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLC
ANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYR
HYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIA
THGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNS
SNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC
TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLD
QALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSE
QLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTV
LRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDA
MNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFS
TFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR
KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA
AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA
CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITG
NTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG
AVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV
VPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGP
KVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVC
GMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYAL
RHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLC
LFDRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKE
GSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAA
TRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECL
YRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVF
HLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVG
SDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRI
TGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYI
GDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQT
TETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATR
DAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWG
FTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIV
CRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGE
APVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIGES
VKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVT
IDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWD
LIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLL
EKGRLIIRENNRVVVSSDILVNN
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P0C6X7(R1AB_SARS)]

7073
region name description
1-180 CHAIN /note="Host translation inhibitor nsp1" /id="PRO_0000037309"
181-818 CHAIN /note="Non-structural protein 2" /id="PRO_0000037310"
819-2740 CHAIN /note="Papain-like protease nsp3" /id="PRO_0000037311"
2741-3240 CHAIN /note="Non-structural protein 4" /id="PRO_0000283841"
3241-3546 CHAIN /note="3C-like proteinase nsp5" /id="PRO_0000037312"
3547-3836 CHAIN /note="Non-structural protein 6" /id="PRO_0000037313"
3837-3919 CHAIN /note="Non-structural protein 7" /id="PRO_0000037314"
3920-4117 CHAIN /note="Non-structural protein 8" /id="PRO_0000037315"
4118-4230 CHAIN /note="Viral protein genome-linked nsp9" /id="PRO_0000037316"
4231-4369 CHAIN /note="Non-structural protein 10" /id="PRO_0000037317"
4370-5301 CHAIN /note="RNA-directed RNA polymerase nsp12" /id="PRO_0000037318"
5302-5902 CHAIN /note="Helicase nsp13" /id="PRO_0000037319"
5903-6429 CHAIN /note="Guanine-N7 methyltransferase nsp14" /id="PRO_0000037320"
6430-6775 CHAIN /note="Uridylate-specific endoribonuclease nsp15" /id="PRO_0000037321"
6776-7073 CHAIN /note="2'-O-methyltransferase nsp16" /id="PRO_0000037322"
1-2202 TOPO_DOM /note="Cytoplasmic"
2203-2223 TRANSMEM /note="Helical"
2224-2303 TOPO_DOM /note="Lumenal"
2304-2324 TRANSMEM /note="Helical"
2325-2754 TOPO_DOM /note="Cytoplasmic"
2755-2775 TRANSMEM /note="Helical"
2776-3021 TOPO_DOM /note="Lumenal"
3022-3042 TRANSMEM /note="Helical"
3043-3076 TOPO_DOM /note="Cytoplasmic"
3077-3097 TRANSMEM /note="Helical"
3098-3104 TOPO_DOM /note="Lumenal"
3105-3125 TRANSMEM /note="Helical"
3126-3563 TOPO_DOM /note="Cytoplasmic"
3564-3584 TRANSMEM /note="Helical"
3585-3585 TOPO_DOM /note="Lumenal"
3586-3606 TRANSMEM /note="Helical"
3607-3611 TOPO_DOM /note="Cytoplasmic"
3612-3632 TRANSMEM /note="Helical"
3633-3657 TOPO_DOM /note="Lumenal"
3658-3678 TRANSMEM /note="Helical"
3679-3727 TOPO_DOM /note="Cytoplasmic"
3728-3748 TRANSMEM /note="Helical"
3749-3755 TOPO_DOM /note="Lumenal"
3756-3776 TRANSMEM /note="Helical"
3777-7073 TOPO_DOM /note="Cytoplasmic"
12-127 DOMAIN /note="CoV Nsp1 globular"
148-179 DOMAIN /note="BetaCoV Nsp1 C-terminal"
183-456 DOMAIN /note="CoV Nsp2 N-terminal"
458-688 DOMAIN /note="CoV Nsp2 middle"
690-818 DOMAIN /note="CoV Nsp2 C-terminal"
822-930 DOMAIN /note="Ubiquitin-like 1"
1003-1169 DOMAIN /note="Macro 1"
1207-1335 DOMAIN /note="Macro 2"
1343-1470 DOMAIN /note="Macro 3"
1472-1538 DOMAIN /note="DPUP"
1542-1597 DOMAIN /note="Ubiquitin-like 2"
1611-1875 DOMAIN /note="Peptidase C16"
1888-1998 DOMAIN /note="Nucleic acid-binding"
2023-2132 DOMAIN /note="G2M"
2224-2294 DOMAIN /note="3Ecto"
2372-2740 DOMAIN /note="CoV Nsp3 Y"
3142-3240 DOMAIN /note="Nsp4C"
3241-3546 DOMAIN /note="Peptidase C30"
3837-3919 DOMAIN /note="RdRp Nsp7 cofactor"
3920-4117 DOMAIN /note="RdRp Nsp8 cofactor"
4118-4230 DOMAIN /note="Nsp9 ssRNA-binding"
4231-4369 DOMAIN /note="ExoN/MTase coactivator"
4376-4630 DOMAIN /note="NiRAN"
4635-4733 DOMAIN /note="Nsp12 Interface"
4734-5301 DOMAIN /note="Nsp12 RNA-dependent RNA polymerase"
4981-5143 DOMAIN /note="RdRp catalytic"
5302-5385 DOMAIN /note="CV ZBD"
5558-5739 DOMAIN /note="(+)RNA virus helicase ATP-binding"
5740-5909 DOMAIN /note="(+)RNA virus helicase C-terminal"
5974-6189 DOMAIN /note="ExoN"
6198-6429 DOMAIN /note="N7-MTase"
6430-6490 DOMAIN /note="Nsp15 N-terminal oligomerization"
6491-6616 DOMAIN /note="AV-Nsp11N/CoV-Nsp15M"
6633-6772 DOMAIN /note="NendoU"
6777-7071 DOMAIN /note="Nidovirus-type SAM-dependent 2'-O-MTase"
1729-1766 ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590"
4304-4320 ZN_FING
4347-4360 ZN_FING
200-236 REGION /note="C2H2"
323-344 REGION /note="C4"
370-416 REGION /note="C2HC"
972-1003 REGION /note="Disordered"
1175-1198 REGION /note="Disordered"
2203-2324 REGION /note="HD1"
2372-2462 REGION /note="Y1"
2376-2389 REGION /note="ZF1"
2422-2432 REGION /note="ZF2"
2463-2740 REGION /note="CoV-Y"
2463-2557 REGION /note="Y2"
2558-2639 REGION /note="Y3"
2640-2740 REGION /note="Y4"
2755-3125 REGION /note="HD2"
3564-3776 REGION /note="HD3"
4736-4950 REGION /note="RdRp Fingers N-ter"
4951-4989 REGION /note="RdRp Palm N-ter"
4990-5048 REGION /note="RdRp Fingers C-ter"
5049-5184 REGION /note="RdRp Palm C-ter"
5185-5301 REGION /note="RdRp Thumb"
6316-6330 REGION /note="GpppA-binding"
972-997 COMPBIAS /note="Acidic residues"
1651-1651 ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590"
1812-1812 ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590"
1826-1826 ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590"
3281-3281 ACT_SITE /note="For 3CL-PRO activity"
3385-3385 ACT_SITE /note="For 3CL-PRO activity"
5128-5128 ACT_SITE
5129-5129 ACT_SITE
5130-5130 ACT_SITE
5992-5992 ACT_SITE
5994-5994 ACT_SITE
6093-6093 ACT_SITE
6170-6170 ACT_SITE
6175-6175 ACT_SITE
6663-6663 ACT_SITE
6678-6678 ACT_SITE
6718-6718 ACT_SITE
6821-6821 ACT_SITE
6905-6905 ACT_SITE
6945-6945 ACT_SITE
6978-6978 ACT_SITE
200-200 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
231-231 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
234-234 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
236-236 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1"
323-323 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
326-326 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
341-341 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
344-344 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2"
370-370 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3"
373-373 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3"
382-382 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3"
416-416 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3"
1729-1729 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6"
1732-1732 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6"
1764-1764 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6"
1766-1766 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6"
2376-2376 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4"
2381-2381 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4"
2386-2386 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4"
2389-2389 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4"
2422-2422 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5"
2425-2425 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5"
2429-2429 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5"
2432-2432 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5"
4304-4304 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ECO:0000269|PubMed:22022266"
4307-4307 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ECO:0000269|PubMed:22022266"
4313-4313 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ECO:0000269|PubMed:22022266"
4320-4320 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ECO:0000269|PubMed:22022266"
4347-4347 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ECO:0000269|PubMed:22022266"
4350-4350 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ECO:0000269|PubMed:22022266"
4358-4358 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ECO:0000269|PubMed:22022266"
4360-4360 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ECO:0000269|PubMed:22022266"
4578-4578 BINDING /ligand="Mn(2+)" /ligand_id="ChEBI:CHEBI:29035"
4587-4587 BINDING /ligand="Mn(2+)" /ligand_id="ChEBI:CHEBI:29035"
4664-4664 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="9"
4670-4670 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="9"
4675-4675 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="9"
4679-4679 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="9"
4856-4856 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="10"
5011-5011 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="10"
5014-5014 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="10"
5015-5015 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="10"
5306-5306 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="11"
5309-5309 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="11"
5317-5317 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="12"
5320-5320 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="11"
5327-5327 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="11"
5330-5330 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="12"
5334-5334 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="12"
5340-5340 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="12"
5351-5351 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="13"
5356-5356 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="13"
5373-5373 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="13"
5376-5376 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="13"
5583-5590 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
5994-5994 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_label="2"
6093-6093 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_label="1"
6109-6109 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="14"
6112-6112 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="14"
6128-6128 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="14"
6131-6131 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="14"
6159-6159 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="15"
6163-6163 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="15"
6166-6166 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="15"
6170-6170 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_label="2"
6175-6175 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_label="2"
6181-6181 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="15"
6233-6239 BINDING /ligand="S-adenosyl-L-methionine" /ligand_id="ChEBI:CHEBI:59789"
6354-6354 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="16"
6375-6375 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="16"
6386-6386 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="16"
6389-6389 BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="16"
1-7073 DISORDER predicted by DISOPRED

MONOMER
7073
pdb_id a1 identity[%]2 description
8gwe A 96.3 R1AB_SARS2 RNA-directed RNA polymerase
7egq R 99.8 R1AB_SARS2 Helicase
5c8u D 100.0 R1AB_CVHSA Guanine-N7 methyltransferase
7fac A 100.0 R1A_SARS Non-structural protein 2
7msw A 68.3 R1AB_SARS2 Non-structural protein 2
2h85 A 99.4 Q6VA80_CVHSA Putative orf1ab polyprotein
4m0w A 99.7 R1A_CVHSA Replicase polyprotein 1a
5b6o A 99.7 R1AB_CVHSA 3C-like proteinase
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1uk4[2] C 5-mer peptide of inhibitor[6 aa] A 100.0
/100.0
18
/18
R1AB_SARS 3C-like proteinase nsp5
1uk4[1] E 5-mer peptide of inhibitor[5 aa] B 100.0
/100.0
2
/2
R1AB_SARS 3C-like proteinase nsp5
2amq[2] C N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
24
/24
R1AB_CVHSA 3C-like proteinase
2hob[10] B N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. A 100.0
/100.0
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
3iwm[4] H N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]ALANYL-L-VALYL-.. C 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2z3c[4] B inhibitor[5 aa] A 100.0
/100.0
19
/19
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
2z3d[2] B Inhibitor[5 aa] A 100.0
/100.0
18
/18
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3sna[2] B Peptide aldehyde inhibitor Ac-NSFSQ-H[6 aa] A 100.0
/100.0
17
/17
R1A_CVHSA 3C-like proteinase
3snb[2] B Peptide aldehyde inhibitor Ac-DSFDQ-H[6 aa] A 100.0
/100.0
19
/19
R1A_CVHSA 3C-like proteinase
3snc[2] B Peptide aldehyde inhibitor Ac-NSTSQ-H[6 aa] A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
3snd[2] C Peptide aldehyde inhibitor Ac-ESTLQ-H[2 aa] A 100.0
/100.0
12
/12
R1A_CVHSA 3C-like proteinase
3sne[2] B Peptide aldehyde inhibitor Ac-ESTLQ-H[6 aa] A 100.0
/100.0
21
/21
R1A_CVHSA 3C-like proteinase
3vb4[4] C B4Z inhibitor[5 aa] A 100.0
/100.0
21
/21
R1A_CVHSA 3C-like proteinase
3vb4[1] C B4Z inhibitor[5 aa] B 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb6[2] C C6Z inhibitor[4 aa] A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
3vb6[1] D C6Z inhibitor[4 aa] A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3vb7[2] C M4Z inhibitor[4 aa] A 100.0
/100.0
20
/20
R1A_CVHSA 3C-like proteinase
3vb7[1] C M4Z inhibitor[4 aa] B 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
4m0w[4] B RS27A_BOVIN Ubiquitin[76 aa] A 96.2
/99.7
26
/26
R1A_CVHSA Replicase polyprotein 1a
5e6j[2] C UBB_HUMAN Polyubiquitin-B[75 aa] A 100.0
/99.1
11
/11
R1AB_CVHSA Replicase polyprotein 1ab
5tl6[2] D ISG15_HUMAN Ubiquitin-like protein ISG15[78 aa] A 100.0
/100.0
21
/21
R1AB_CVHSA Replicase polyprotein 1ab
5tl7[2] A ISG15_MOUSE Ubiquitin-like protein ISG15[77 aa] B 100.0
/100.0
27
/27
R1AB_CVHSA Replicase polyprotein 1ab
7lfu[3] B Papain-like protease peptide inhibitor VIR250[5 aa.. A 100.0
/100.0
16
/16
R1A_SARS papain-like protease
6xez[26] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
7cxn[1] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
7egq[2] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
7egq[2] I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/95.0
17
/17
R1AB_SARS2 Proofreading exoribonuclease
7re3[2] J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] F 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
3aw0[2] B peptide ACE-SER-ALA-VAL-LEU-HIS-H[6 aa] A 100.0
/99.7
18
/18
R1A_CVHSA 3C-Like Proteinase
2q6g[1] C Polypeptide chain[11 aa] A 100.0
/99.7
24
/24
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
2q6g[1] D Polypeptide chain[8 aa] B 96.0
/99.7
25
/25
R1AB_CVHSA severe acute respiratory syndrome coronavirus (SAR..
3atw[2] C peptide ACE-THR-VAL-ALC-HIS-H[5 aa] A 95.2
/99.7
21
/21
R1A_CVHSA 3C-Like Proteinase
3avz[1] B peptide ACE-SER-ALA-VAL-ALC-HIS-H[6 aa] A 94.7
/99.7
19
/19
R1A_CVHSA 3C-Like Proteinase
7oyg[2] B R1AB_SARS2 SARS-CoV-2 nsp8[81 aa] A 100.0
/96.9
28
/28
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase (nsp12)
7thm[1] C R1AB_SARS2 Non-structural protein 7[37 aa] A 100.0
/96.9
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
7thm[1] E R1AB_SARS2 Non-structural protein 9[74 aa] A 81.2
/96.9
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7bv1[1] D R1AB_SARS2 Non-structural protein 8[99 aa] A 100.0
/96.8
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6m71[1] C R1AB_SARS2 Non-structural protein 8[43 aa] A 100.0
/96.7
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] D R1AB_SARS2 Non-structural protein 8[31 aa] A 100.0
/97.3
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7aap[2] D R1AB_SARS2 Non-structural protein 8[28 aa] A 100.0
/96.3
2
/2
R1AB_SARS2 Non-structural protein 12
6m71[60] B R1AB_SARS2 Non-structural protein 7[70 aa] A 100.0
/96.7
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
6xez[6] C R1AB_SARS2 Non-structural protein 7[73 aa] E 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
7bw4[1] C R1AB_SARS2 Non-structural protein 7[65 aa] A 100.0
/96.9
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] C R1AB_SARS2 Non-structural protein 7[72 aa] A 100.0
/96.3
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] C R1AB_SARS2 Non-structural protein 7[72 aa] E 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
6m71[59] D R1AB_SARS2 Non-structural protein 8[113 aa] A 100.0
/96.7
46
/46
R1AB_SARS2 RNA-directed RNA polymerase
6nur[1] D R1A_CVHSA NSP8[109 aa] A 100.0
/100.0
2
/2
R1AB_CVHSA NSP12
6xez[38] D R1AB_SARS2 Non-structural protein 8[186 aa] A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
6xez[19] D R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
7btf[6] D R1AB_SARS2 Non-structural protein 8[104 aa] A 100.0
/96.3
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] B R1AB_SARS2 Non-structural protein 8[115 aa] A 100.0
/96.9
42
/42
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[24] B R1AB_SARS2 Non-structural protein 8[187 aa] H 100.0
/99.8
11
/11
R1AB_SARS2 Helicase
7cxm[3] D R1AB_SARS2 Non-structural protein 8[186 aa] I 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
7cyq[10] B R1AB_SARS2 Non-structural protein 8[187 aa] G 100.0
/99.8
2
/2
R1AB_SARS2 Helicase
7ed5[1] B R1AB_SARS2 Non-structural protein 8[150 aa] A 100.0
/96.3
52
/52
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] D R1AB_SARS2 Non-structural protein 8[154 aa] A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] B R1AB_SARS2 Non-structural protein 8[187 aa] E 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
7egq[1] D R1AB_SARS2 Non-structural protein 8[186 aa] P 100.0
/95.0
1
/1
R1AB_SARS2 Proofreading exoribonuclease
7l1f[1] B R1AB_SARS2 Non-structural protein 8[114 aa] A 100.0
/96.8
40
/40
R1AB_SARS2 RNA-directed RNA polymerase
7rdz[1] D R1AB_SARS2 Non-structural protein 8[185 aa] E 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
7re0[1] B R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/99.8
2
/2
R1AB_SARS2 Helicase
7re3[2] G R1AB_SARS2 Non-structural protein 8[186 aa] A 75.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[14] I R1AB_SARS2 Non-structural protein 9[113 aa] A 78.9
/96.3
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7egq[3] F R1AB_SARS2 Non-structural protein 9[113 aa] H 100.0
/95.0
4
/4
R1AB_SARS2 Proofreading exoribonuclease
6xez[25] E R1AB_SARS2 Helicase[596 aa] A 100.0
/96.3
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7cxn[1] H R1AB_SARS2 Helicase[596 aa] A 100.0
/96.2
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] M R1AB_SARS2 Helicase[588 aa] H 100.0
/95.0
5
/5
R1AB_SARS2 Proofreading exoribonuclease
7re3[2] N R1AB_SARS2 Helicase[590 aa] A 50.0
/96.3
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7egq[3] H R1AB_SARS2 Proofreading exoribonuclease[523 aa] A 100.0
/96.3
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] P R1AB_SARS2 Proofreading exoribonuclease[524 aa] A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] P R1AB_SARS2 Proofreading exoribonuclease[524 aa] E 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
8sq9[1] E R1AB_SARS2 Non-structural protein 9[98 aa] A 80.0
/96.3
20
/20
R1AB_SARS2 RNA-directed RNA polymerase
5c8s[15] A R1AB_CVHSA Non-structural protein 10[133 aa] B 100.0
/100.0
49
/49
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] E Q1T6X8_CVHSA Polyprotein 1ab[132 aa] A 100.0
/99.8
50
/50
Q1T6X8_CVHSA Polyprotein 1ab
7n0d[2] C R1AB_SARS2 Non-structural protein 10[131 aa] B 100.0
/94.7
4
/4
R1AB_SARS2 Proofreading exoribonuclease
8g6r[1] B A0A1Z2R8Q6_9ALPC nsp8[114 aa] A 53.5
/60.5
43
/44
A0A0U2C263_9ALPC nsp12
8g6r[2] C A0A0M4AW09_9ALPC nsp7[62 aa] A 81.2
/60.5
16
/16
A0A0U2C263_9ALPC nsp12
8urb[1] B U6BRU0_9ALPC nsp8[184 aa] A 54.3
/60.3
46
/47
U6BRU0_9ALPC nsp12
8urb[1] D U6BRU0_9ALPC nsp8[184 aa] A 66.7
/60.3
12
/12
U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cxm[2] G RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') I 100.0
/99.8
20
/20
R1AB_SARS2 Helicase
7krn[2] G RNA (43-MER) A 100.0
/96.3
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7krn[2] G RNA (43-MER) E 100.0
/99.8
32
/32
R1AB_SARS2 Helicase
7rdx[1] H Template RNA A 100.0
/96.3
34
/34
R1AB_SARS2 RNA-directed RNA polymerase
7rdx[1] H Template RNA E 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
7rdy[1] H Template RNA A 100.0
/96.3
32
/32
R1AB_SARS2 RNA-directed RNA polymerase
7rdy[1] H Template RNA E 100.0
/99.8
30
/30
R1AB_SARS2 Helicase
7eiz[2] H template A 100.0
/96.3
21
/21
R1AB_SARS2 RNA-directed RNA polymerase
8gwe[1] J template F 100.0
/99.8
1
/1
R1AB_SARS2 Helicase nsp13
8gw1[1] F Template A 100.0
/96.2
23
/23
R1AB_SARS2 Replicase polyprotein 1ab
8gw1[1] F Template G 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
6xqb[1] E RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/97.3
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[1] F RNA (5'-R(*GP*UP*GP*GP*GP*CP*CP*CP*A)-3') A 100.0
/97.3
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7b3b[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*G)-D(P*(RMP))-R(.. A 100.0
/96.9
14
/14
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3b[1] E RNA (5'-R(P*UP*GP*CP*AP*UP*CP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/96.9
28
/28
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c[1] D DNA/RNA (5'-R(P*CP*UP*AP*CP*GP*CP*A)-D(P*(RMP))-R(.. A 100.0
/96.9
16
/16
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3c[1] E RNA (5'-R(P*UP*CP*AP*CP*UP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/96.9
26
/26
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7b3d[3] D RNA (5'-R(P*CP*UP*AP*CP*GP*CP*AP*GP*UP*G)-3') A 100.0
/96.9
14
/14
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7b3d[3] E RNA (5'-R(P*UP*GP*CP*AP*CP*UP*GP*CP*GP*UP*AP*G)-3'.. A 100.0
/96.9
29
/29
R1AB_SARS2 SARS-CoV-2 RNA-dependent RNA polymerase nsp12
7ozu[1] D Product RNA A 100.0
/96.9
14
/14
R1AB_SARS2 Replicase polyprotein 1ab
7ozu[2] E Template RNA A 100.0
/96.9
30
/30
R1AB_SARS2 Replicase polyprotein 1ab
7ozv[1] D Product RNA A 100.0
/96.9
12
/12
R1AB_SARS2 Replicase polyprotein 1ab
6yyt[1] E RNA product A 100.0
/96.8
14
/14
R1AB_SARS2 nsp12
6yyt[1] G RNA product A 100.0
/96.8
26
/26
R1AB_SARS2 nsp12
7bv2[1] D Primer A 100.0
/96.8
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7bv2[1] E Templete A 100.0
/96.8
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] D RNA (5'-R(P*CP*UP*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*U*.. A 100.0
/96.8
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7l1f[1] E RNA (5'-R(P*AP*UP*UP*UP*UP*AP*AP*UP*AP*GP*CP*UP*UP.. A 100.0
/96.8
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] E Primer-RNA (5'-R(P*UP*UP*CP*UP*CP*CP*UP*AP*AP*GP*A.. A 100.0
/96.7
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
7ctt[1] F Template-RNA (5'-R(P*AP*CP*UP*AP*GP*CP*UP*UP*CP*UP.. A 100.0
/96.7
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7dok[1] B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/96.4
26
/26
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[1] B RNA (5'-R(P*CP*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. C 100.0
/96.4
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
7dfh[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*G*(LIG))-3') A 100.0
/96.4
13
/13
R1AB_SARS2 RNA-directed RNA polymeras
7dfh[1] F RNA (5'-R(P*CP*CP*CP*CP*CP*AP*CP*AP*UP*AP*GP*C)-3'.. A 100.0
/96.4
24
/24
R1AB_SARS2 RNA-directed RNA polymeras
8gwe[1] H RNA (5'-R(P*AP*UP*UP*A)-3') A 100.0
/96.3
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
7uob[2] E Product RNA (35-MER) A 100.0
/96.3
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7uob[1] F Template RNA (55-MER) A 100.0
/96.3
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7uoe[1] F Template RNA (55-MER) A 100.0
/96.3
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
8sqj[1] F Primer RNA A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
8sqj[1] G Template RNA A 100.0
/96.3
23
/23
R1AB_SARS2 RNA-directed RNA polymerase
8sqj[1] H SARS-CoV-2 5' UTR A 100.0
/96.3
18
/18
R1AB_SARS2 RNA-directed RNA polymerase
8sqk[1] F Primer RNA A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk[1] G Template RNA A 100.0
/96.3
23
/23
R1AB_SARS2 RNA-directed RNA polymerase nsp12
8sqk[1] H SARS-CoV-2 5' UTR A 100.0
/96.3
8
/8
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7dte[1] E RNA (57-MER) A 100.0
/96.3
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7dte[1] F RNA (33-MER) A 100.0
/96.3
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
6xez[9] G Product RNA A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] E RNA (29-MER) A 100.0
/96.3
24
/24
R1AB_SARS2 RNA-directed RNA polymerase
7c2k[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7krn[3] F RNA (37-MER) A 100.0
/96.3
20
/20
R1AB_SARS2 RNA-directed RNA polymerase
7krp[1] F RNA (36-MER) A 100.0
/96.3
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7rdz[6] H Template RNA A 100.0
/96.3
31
/31
R1AB_SARS2 RNA-directed RNA polymerase
7uo4[1] E Product RNA (35-MER) A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7uo4[1] F Template RNA (55-MER) A 100.0
/96.3
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
6xez[1] H Template RNA A 100.0
/96.3
21
/21
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[13] E RNA (25-MER) A 100.0
/96.2
10
/10
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] E Primer A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] F Template A 100.0
/96.3
30
/30
R1AB_SARS2 RNA-directed RNA polymerase
7dok[1] A RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. C 100.0
/96.4
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] E RNA (5'-R(P*GP*CP*UP*AP*UP*GP*UP*GP*AP*GP*AP*UP*UP.. A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] F RNA (5'-R(P*CP*CP*CP*CP*AP*UP*AP*AP*CP*UP*UP*AP*AP.. A 100.0
/96.3
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] T Template RNA A 100.0
/96.3
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7egq[1] T Template RNA E 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
7uo7[1] D Product RNA (35-MER) A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7uo7[1] E Template RNA (55-MER) A 100.0
/96.3
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[1] D Product RNA (35-MER) A 100.0
/96.3
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[2] E Template RNA (55-MER) A 100.0
/96.3
34
/34
R1AB_SARS2 RNA-directed RNA polymerase
8gwb[1] H RNA (5'-R(P*AP*U)-3') A 100.0
/96.3
9
/9
R1AB_SARS2 RNA-directed RNA polymerase
8gwb[6] J template A 100.0
/96.3
27
/27
R1AB_SARS2 RNA-directed RNA polymerase
8gwb[4] J template E 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
8sq9[1] F Primer RNA A 100.0
/96.3
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] E RNA (31-MER) A 100.0
/96.3
25
/25
R1AB_SARS2 RNA-directed RNA polymerase
7bzf[1] F RNA (5'-R(*UP*GP*UP*UP*CP*GP*AP*CP*GP*AP*CP*AP*CP*.. A 100.0
/96.3
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
7aap[1] E RNA (5'-R(P*UP*UP*AP*AP*GP*UP*UP*AP*U)-3') A 100.0
/96.3
16
/16
R1AB_SARS2 Non-structural protein 12
7aap[1] F RNA (5'-R(P*UP*UP*CP*AP*UP*AP*AP*CP*UP*UP*AP*A)-3'.. A 100.0
/96.3
23
/23
R1AB_SARS2 Non-structural protein 12
7dfg[2] A RNA (5'-R(P*AP*GP*AP*UP*UP*AP*AP*GP*UP*UP*AP*U)-3'.. C 100.0
/96.4
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7doi[1] E RNA (5'-R(P*CP*CP*UP*AP*UP*AP*AP*CP*UP*UP*AP*AP*UP.. A 100.0
/96.2
28
/28
R1AB_SARS2 RNA-directed RNA polymerase
7cxm[2] F RNA (26-MER) A 100.0
/96.2
23
/23
R1AB_SARS2 RNA-directed RNA polymerase
7n0b[1] C RNA (5'-R(*AP*UP*GP*UP*GP*AP*UP*UP*UP*UP*AP*AP*UP*.. B 100.0
/94.9
7
/7
R1AB_SARS2 Proofreading exoribonuclease
7n0b[1] D RNA (5'-R(*AP*GP*AP*AP*GP*CP*UP*AP*UP*UP*AP*AP*AP*.. B 100.0
/94.9
15
/15
R1AB_SARS2 Proofreading exoribonuclease
7n0c[1] C RNA (25-MER) B 100.0
/94.7
10
/10
R1AB_SARS2 Proofreading exoribonuclease
7n0c[1] D RNA (24-MER) B 100.0
/94.7
18
/18
R1AB_SARS2 Proofreading exoribonuclease
7n0d[4] E RNA (5'-R(*GP*GP*GP*GP*AP*UP*GP*UP*GP*AP*UP*UP*UP*.. B 100.0
/94.7
9
/9
R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] F RNA (5'-R(*CP*UP*AP*UP*UP*AP*AP*AP*AP*UP*CP*AP*CP*.. B 100.0
/94.7
16
/16
R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] G RNA (5'-R(*CP*CP*CP*CP*C)-3') B 100.0
/94.7
1
/1
R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] G RNA (5'-R(*CP*CP*CP*CP*C)-3') D 100.0
/94.7
15
/15
R1AB_SARS2 Proofreading exoribonuclease
8g6r[1] D RNA (5'-R(P*AP*AP*GP*AP*AP*GP*CP*UP*AP*UP*UP*AP*AP.. A 93.8
/60.5
16
/16
A0A0U2C263_9ALPC nsp12
8g6r[1] E RNA (5'-R(P*GP*GP*UP*UP*GP*UP*GP*AP*UP*UP*UP*UP*AP.. A 77.8
/60.5
27
/27
A0A0U2C263_9ALPC nsp12
8urb[1] E RNA (33-MER) A 93.8
/60.3
16
/16
U6BRU0_9ALPC nsp12
8urb[1] F RNA (55-MER) A 76.2
/60.3
21
/21
U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1wof[2] C I12
N-[(5-METHYLISOXAZOL-3-YL)CARBONYL]-L-ALANYL-L-VAL..
A 100.0
/100.0
23
/23
R1AB_CVHSA 3C-like proteinase
2a5i[6] B AZP
(5S,8S,14R)-ETHYL 11-(3-AMINO-3-OXOPROPYL)-8-BENZY..
A 100.0
/100.0
23
/23
R1AB_CVHSA 3C-like peptidase
2alv[2] B CY6
N-((3S,6R)-6-((S,E)-4-ETHOXYCARBONYL-1-((S)-2-OXOP..
A 100.0
/100.0
24
/24
R1AB_CVHSA Replicase polyprotein 1ab
2amd[2] C 9IN
N-(3-FUROYL)-D-VALYL-L-VALYL-N~1~-((1R,2Z)-4-ETHOX..
A 100.0
/100.0
23
/23
R1AB_CVHSA 3C-like proteinase
2d2d[2] C ENB
ETHYL (2E,4S)-4-[((2R)-2-{[N-(TERT-BUTOXYCARBONYL)..
A 100.0
/100.0
21
/21
R1AB_CVHSA 3C-like proteinase
2gx4[2] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/100.0
22
/22
R1AB_CVHSA 3C-like proteinase
2gx4[2] B NOL
N-[(BENZYLOXY)CARBONYL]-O-(TERT-BUTYL)-L-THREONYL-..
A 100.0
/100.0
1
/1
R1AB_CVHSA 3C-like proteinase
2gz7[2] B D3F
2-[(2,4-DICHLORO-5-METHYLPHENYL)SULFONYL]-1,3-DINI..
A 100.0
/100.0
13
/13
R1AB_CVHSA Replicase polyprotein 1ab
2gz8[2] B F3F
S-[5-(TRIFLUOROMETHYL)-4H-1,2,4-TRIAZOL-3-YL] 5-(P..
A 100.0
/100.0
14
/14
R1AB_CVHSA Replicase polyprotein 1ab
2op9[2] C WR1
NALPHA-[(BENZYLOXY)CARBONYL]-N-[(1R)-4-HYDROXY-1-M..
A 100.0
/100.0
13
/13
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab, ORF1AB) 3C-like ..
2v6n[2] B XP1
4-(DIMETHYLAMINO)BENZOIC ACID[11 atoms]
A 100.0
/100.0
10
/10
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
2vj1[1] G XP1
4-(DIMETHYLAMINO)BENZOIC ACID[8 atoms]
B 100.0
/100.0
6
/6
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2vj1[1] D BEZ
BENZOIC ACID[9 atoms]
A 100.0
/100.0
8
/8
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2z94[2] C TLD
4-methylbenzene-1,2-dithiol[9 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/100.0
22
/22
R1A_CVHSA 3C-like proteinase
2zu4[2] B ZU3
N-[(benzyloxy)carbonyl]-3-[(2,2-dimethylpropanoyl)..
A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/100.0
22
/22
R1A_CVHSA 3C-like proteinase
2zu5[2] B ZU5
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-threonyl-N-..
A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3d62[2] B 959
benzyl (2-oxopropyl)carbamate[15 atoms]
A 100.0
/100.0
10
/10
R1AB_CVHSA 3C-like proteinase
3mj5[1] C GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/100.0
9
/9
R1A_CVHSA Replicase polyprotein 1a
3mj5[1] E GRM
N-(1,3-benzodioxol-5-ylmethyl)-1-[(1R)-1-naphthale..
A 100.0
/100.0
4
/4
R1A_CVHSA Replicase polyprotein 1a
3sn8[2] B S89
N-[(2S)-1-hydroxy-3-phenylpropan-2-yl]-Nalpha-[(2E..
A 100.0
/100.0
15
/15
R1A_CVHSA 3C-like proteinase
3szn[2] B G75
ETHYL (4R)-4-({N-[(BENZYLOXY)CARBONYL]-L-PHENYLALA..
A 100.0
/100.0
17
/17
R1A_CVHSA 3C-like proteinase
3tit[2] B G81
ETHYL (4R)-4-{[N-(TERT-BUTOXYCARBONYL)-L-PHENYLALA..
A 100.0
/100.0
15
/15
R1A_CVHSA SARS coronavirus main protease
3tiu[2] C G82
ETHYL (5S,8S,11R)-8-BENZYL-5-(3-TERT-BUTOXY-3-OXOP..
A 100.0
/100.0
23
/23
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/100.0
24
/24
R1A_CVHSA SARS coronavirus main protease
3tns[2] B G83
ETHYL (5S,8S,11R)-8-BENZYL-5-(2-TERT-BUTOXY-2-OXOE..
A 100.0
/100.0
1
/1
R1A_CVHSA SARS coronavirus main protease
3tnt[2] B G85
N-[(benzyloxy)carbonyl]-O-tert-butyl-L-seryl-N-{(2..
A 100.0
/100.0
22
/22
R1A_CVHSA SARS coronavirus main protease
3v3m[2] B 0EN
N-[(1R)-2-(tert-butylamino)-2-oxo-1-(pyridin-3-yl)..
A 100.0
/100.0
15
/15
R1A_CVHSA 3C-like proteinase
4mds[2] B 23H
N-[4-(acetylamino)phenyl]-2-(1H-benzotriazol-1-yl)..
A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
4ovz[1] D P85
N-[(4-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/100.0
11
/11
R1A_CVHSA Papain-like proteinase
4ow0[1] D S88
N-[(3-fluorophenyl)methyl]-1-[(1R)-1-naphthalen-1-..
A 100.0
/100.0
10
/10
R1A_CVHSA papain-like protease
5c8s[2] L G3A
GUANOSINE-P3-ADENOSINE-5',5'-TRIPHOSPHATE[50 atoms..
B 100.0
/100.0
16
/16
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[2] K SAM
S-ADENOSYLMETHIONINE[27 atoms]
B 100.0
/100.0
13
/13
R1AB_CVHSA Guanine-N7 methyltransferase
5n19[2] B D03
(S)-N-benzyl-3-((S)-2-cinnamamido-3-phenylpropanam..
A 100.0
/100.0
21
/21
R1AB_CVHSA SARS coronavirus main protease
5n5o[2] B 8O5
(2~{R},3~{S})-3-[[(2~{S})-3-cyclopropyl-2-[[(~{E})..
A 100.0
/100.0
17
/17
R1AB_CVHSA Replicase polyprotein 1ab
6lnq[1] B EJF
N-[(2S)-3-methyl-1-[[(2S)-4-methyl-1-oxidanylidene..
A 100.0
/100.0
19
/19
Severe Acute Respiratory Syndrome Coronavirus 3c L..
6lny[1] B EOC
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/100.0
16
/16
R1A_CVHSA Replicase polyprotein 1a
6lo0[1] B EOF
(2~{S})-4-methyl-~{N}-[(2~{S})-1-oxidanylidene-3-[..
A 100.0
/100.0
18
/18
R1A_CVHSA Replicase polyprotein 1a
6w79[2] C X77
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclohexylamino)..
A 100.0
/100.0
17
/17
Main protease
6wco[2] D X47
N-(4-tert-butylphenyl)-N-[(1R)-2-(cyclopentylamino..
A 100.0
/100.0
17
/17
A0A3G5BIY8_CVHSA Main protease
6xhl[2] C V2M
N-[(2S)-1-({(2S,3S)-3,4-dihydroxy-1-[(3S)-2-oxopyr..
A 100.0
/100.0
18
/18
R1A_CVHSA 3C-like proteinase
6xhn[2] C V3D
(3S)-3-{[N-(4-methoxy-1H-indole-2-carbonyl)-L-leuc..
A 100.0
/100.0
17
/17
R1A_CVHSA 3C-like proteinase
6xho[1] D V34
ethyl (2E,4S)-4-{[N-(4-methoxy-1H-indole-2-carbony..
A 100.0
/100.0
19
/19
R1A_CVHSA 3C-like proteinase
6y7m[2] B OEW
~{tert}-butyl ~{N}-[1-[(2~{S})-3-cyclohexyl-1-[[(2..
A 100.0
/100.0
20
/20
R1A_SARS 3C-like proteinase
7end[2] B J7R
~{N}-[(1~{S},2~{R})-2-[[4-bromanyl-2-(methylcarbam..
A 100.0
/100.0
17
/17
R1A_CVHSA Replicase polyprotein 1a
7end[2] B J7R
~{N}-[(1~{S},2~{R})-2-[[4-bromanyl-2-(methylcarbam..
A 100.0
/100.0
1
/1
R1A_CVHSA Replicase polyprotein 1a
7eo8[1] C FNO
2-[(1R)-4-methyl-1-oxidanyl-pent-3-enyl]-5,8-bis(o..
A 100.0
/100.0
8
/8
R1A_CVHSA 3C-like proteinase
7k0h[1] F VR4
N-{(2S,3R)-4-(benzylamino)-3-hydroxy-4-oxo-1-[(3S)..
B 100.0
/100.0
16
/16
R1A_CVHSA Replicase polyprotein 1a
7lcp[4] B UED
N~2~-[(benzyloxy)carbonyl]-N-{(2S)-1-hydroxy-3-[(3..
A 100.0
/100.0
14
/14
R1AB_SARS 3C-like proteinase
7lmg[2] C Y6G
2-(benzotriazol-1-yl)-~{N}-[4-(1~{H}-imidazol-4-yl..
A 100.0
/100.0
17
/17
R1A_SARS 3C-like proteinase
7lmh[2] B Y6D
2-(benzotriazol-1-yl)-~{N}-(4-pyridin-3-ylphenyl)-..
A 100.0
/100.0
19
/19
R1A_SARS 3C-like proteinase
7lmi[2] C Y6A
2-(benzotriazol-1-yl)-~{N}-[4-(1~{H}-pyrazol-4-yl)..
A 100.0
/100.0
16
/16
R1A_SARS 3C-like proteinase
7lmj[2] E Y67
2-(benzotriazol-1-yl)-~{N}-[(3-chlorophenyl)methyl..
A 100.0
/100.0
18
/18
R1A_SARS 3C-like proteinase
7rc1[2] B 4IO
5-chloropyridin-3-yl 1-(3-nitrobenzene-1-sulfonyl)..
A 100.0
/100.0
14
/14
R1A_SARS 3C-like proteinase
7vlo[2] C 4WI
(1R,2S,5S)-N-{(1E,2S)-1-imino-3-[(3S)-2-oxopyrroli..
A 100.0
/100.0
22
/22
R1A_SARS 3C-like proteinase
7wqi[2] C 80I
[(3~{S})-3-[[(2~{S})-2-[(4-methoxy-1~{H}-indol-2-y..
A 100.0
/100.0
14
/14
R1A_SARS 3C-like proteinase
7ygq[1] C HUR
N-[(2S)-1-[[(2S)-1-(1,3-benzothiazol-2-yl)-1-oxida..
A 100.0
/100.0
20
/20
R1A_SARS 3C-like proteinase nsp5
7zqw[2] B XNV
ethyl (4R)-4-({(2S)-2-[3-{[(5-methyl-1,2-oxazol-3-..
A 100.0
/100.0
19
/19
R1A_SARS 3C-like proteinase nsp5
6xez[12] L ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
A 100.0
/96.3
11
/11
R1AB_SARS2 RNA-directed RNA polymerase
6xez[18] R ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms]
E 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
6xez[8] M 1N7
CHAPSO[35 atoms]
A 33.3
/96.3
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6xez[8] N 1N7
CHAPSO[26 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[10] U 1N7
CHAPSO[36 atoms]
A 100.0
/96.3
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
6xez[9] U 1N7
CHAPSO[36 atoms]
E 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
7n0d[4] LA 1N7
CHAPSO[25 atoms]
B 100.0
/94.7
5
/5
R1AB_SARS2 Proofreading exoribonuclease
5rlk[1] H NYV
1-(propan-2-yl)-1H-imidazole-4-sulfonamide[12 atom..
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rl8[1] C VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
5rl8[1] D VVG
N-(2-fluorophenyl)ethanesulfonamide[13 atoms]
A 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rl9[1] H UR7
1-(3-fluoro-4-methylphenyl)methanesulfonamide[13 a..
B 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rlc[1] H VVM
4-amino-N-phenylbenzene-1-sulfonamide[17 atoms]
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rld[1] H VVY
2-phenoxy-1-(pyrrolidin-1-yl)ethan-1-one[15 atoms]..
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rle[1] H VVP
4-methoxy-1H-indole[11 atoms]
B 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rlg[1] C VW1
(2S)-2-(4-cyanophenoxy)propanamide[14 atoms]
A 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rlh[1] H K2P
2-(trifluoromethoxy)benzoic acid[14 atoms]
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rli[2] C JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
A 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rli[1] I JFM
N-(2-phenylethyl)methanesulfonamide[13 atoms]
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rlj[1] H VW4
(2S)-2-phenylpropane-1-sulfonamide[13 atoms]
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rll[1] H H04
1-(2-ethoxyphenyl)piperazine[15 atoms]
B 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rlm[1] H VW7
N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetam..
B 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
5rlo[1] H UQS
N-[(2-fluorophenyl)methyl]-1H-pyrazol-4-amine[14 a..
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rlp[1] H VWA
(1S)-1-(4-fluorophenyl)-N-methylethan-1-amine[11 a..
B 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rlr[1] H VWD
(1R)-2-(methylsulfonyl)-1-phenylethan-1-ol[13 atom..
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rlt[1] H UVJ
3-(2-methyl-1H-benzimidazol-1-yl)propanamide[15 at..
B 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rlu[1] C JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
A 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
5rlu[1] I JG4
2-(thiophen-2-yl)-1H-imidazole[10 atoms]
B 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rlv[1] C VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rlv[1] D VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
A 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rlv[1] J VWJ
N-(propan-2-yl)-1H-benzimidazol-2-amine[13 atoms]
B 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rlw[1] C S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
A 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rlw[1] I S9S
~{N}-[2-(4-fluorophenyl)ethyl]methanesulfonamide[1..
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rly[1] C K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rly[1] I K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rly[1] J K34
5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole[10 atoms]
B 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rlz[1] C VWM
(3R)-1-acetyl-3-hydroxypiperidine-3-carboxylic aci..
A 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rm0[1] H S7G
~{N}-[(3~{R})-1,2,3,4-tetrahydroquinolin-3-yl]etha..
B 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rm1[1] H RY4
N-[4-(aminomethyl)phenyl]methanesulfonamide[13 ato..
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rm2[1] H UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rm2[1] I UXG
1-(diphenylmethyl)azetidin-3-ol[18 atoms]
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rm3[1] C S7J
2-(trifluoromethyl)pyrimidine-5-carboxamide[13 ato..
A 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rm5[1] H NUA
N-(1-ethyl-1H-pyrazol-4-yl)cyclobutanecarboxamide[..
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rm6[1] H HR5
~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-ca..
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rm7[1] H N0E
~{N}-(4-hydroxyphenyl)-3-phenyl-propanamide[18 ato..
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rma[1] H JHJ
N-(4-methoxyphenyl)-N'-pyridin-4-ylurea[18 atoms]
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rmc[1] H 6SU
methyl 3-(methylsulfonylamino)benzoate[15 atoms]
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rmd[2] C VWY
N-ethyl-4-[(methylsulfonyl)amino]benzamide[16 atom..
A 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5rme[1] C RYM
4-(benzimidazol-1-ylmethyl)benzenecarbonitrile[18 ..
A 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rmg[1] H MUK
4,6-dimethyl-~{N}-phenyl-pyrimidin-2-amine[15 atom..
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rmj[1] C JOV
3-chloro-N-(1-hydroxy-2-methylpropan-2-yl)benzamid..
A 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
5rmm[1] H VXG
(3S,4R)-1-acetyl-4-phenylpyrrolidine-3-carboxylic ..
B 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
7nn0[4] E ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato..
A 100.0
/99.8
16
/16
R1AB_SARS2 SARS-CoV-2 helicase NSP13
5rl7[1] C VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
A 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rl7[1] I VVD
5-(acetylamino)-2-fluorobenzoic acid[14 atoms]
B 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rlb[1] C VVJ
N-cycloheptyl-N-methylmethanesulfonamide[13 atoms]..
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rlf[1] C NY7
N-(2-methoxy-5-methylphenyl)glycinamide[14 atoms]
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rln[1] C NZG
3-(acetylamino)-4-fluorobenzoic acid[14 atoms]
A 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
5rlq[1] C UVA
N-methyl-2-(methylsulfonyl)aniline[12 atoms]
A 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rls[1] C VWG
N-hydroxyquinoline-2-carboxamide[14 atoms]
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rm4[1] H PK4
2-fluoro-N,3-dimethylbenzene-1-sulfonamide[13 atom..
B 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rm8[1] C GQJ
methyl (2~{S},4~{R})-1-(furan-2-ylcarbonyl)-4-oxid..
A 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rmb[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta..
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5rmf[1] C NX7
(2,6-difluorophenyl)(pyrrolidin-1-yl)methanone[15 ..
A 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rmh[1] C VX4
[(4S)-4-methylazepan-1-yl](1,3-thiazol-4-yl)methan..
A 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
5rmi[1] C STV
~{N}-(1,3-benzodioxol-5-ylmethyl)ethanesulfonamide..
A 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
5rml[1] H VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms]
B 100.0
/99.8
8
/8
R1AB_SARS2 Helicase
7nng[2] C UJK
1-(2-methylphenyl)-1,2,3-triazole-4-carboxylic aci..
A 100.0
/99.8
8
/8
R1AB_SARS2 SARS-CoV-2 helicase NSP13
4m0w[1] E NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/99.7
7
/7
R1A_CVHSA Replicase polyprotein 1a
4m0w[1] F NHE
2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID[13 atoms..
A 100.0
/99.7
6
/6
R1A_CVHSA Replicase polyprotein 1a
4tww[2] C 3A7
(2S)-2-({[(3S,4aR,8aS)-2-(4-bromobenzoyl)decahydro..
A 93.3
/99.7
15
/15
R1AB_CVHSA 3C-like proteinase
4twy[2] B 3BL
(2S)-2-({[(3S,4aR,8aS)-2-(biphenyl-4-ylcarbonyl)de..
A 94.4
/99.7
18
/18
R1AB_CVHSA 3C-like proteinase
4wy3[1] B 3X5
(2S)-2-({[(3R,4aS,8aR)-2-(biphenyl-4-ylcarbonyl)de..
A 93.8
/99.7
16
/16
R1AB_CVHSA 3C-like proteinase
5c5n[2] B SLH
(2S)-3-(1H-imidazol-5-yl)-2-({[(3R,4aS,8aR)-2-(N-p..
A 93.3
/99.7
15
/15
R1AB_CVHSA 3C-like proteinase
6w2a[1] E QYS
(1S,2S)-2-[(N-{[(4,4-difluorocyclohexyl)methoxy]ca..
B 100.0
/99.7
18
/18
R1A_CVHSA Replicase polyprotein 1a
6w2a[1] C VDJ
[4,4-bis(fluoranyl)cyclohexyl]methyl ~{N}-[(2~{S})..
A 100.0
/99.7
16
/16
R1A_CVHSA Replicase polyprotein 1a
2qiq[2] B CYV
ETHYL (4R)-4-{[(2R,5S)-5-{[N-(TERT-BUTOXYCARBONYL)..
A 100.0
/99.7
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
5c5o[2] C SDJ
(2S)-3-(1H-imidazol-5-yl)-2-({[(3S,4aR,8aS)-2-(N-p..
A 94.1
/99.7
17
/17
R1AB_CVHSA 3C-like proteinase
7skr[2] B 9OZ
N-[(2-methoxypyridin-4-yl)methyl]-2-[(1R)-1-(napht..
A 100.0
/97.8
10
/10
Q0QDZ2_SARS 3C-like proteinase
3e9s[1] B TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/100.0
10
/10
R1A_CVHSA Non-structural protein 3
7skq[1] E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be..
A 100.0
/97.8
10
/10
Q0QDZ2_SARS 3C-like proteinase
7bv2[1] K F86
[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1-..
A 100.0
/96.8
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
8gy6[1] E GO3
Gossypol[38 atoms]
A 100.0
/96.7
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
8gy6[1] F GO3
Gossypol[38 atoms]
A 100.0
/96.7
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7aap[2] M GE6
[[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-5-f..
A 100.0
/96.3
7
/7
R1AB_SARS2 Non-structural protein 12
7doi[2] O HCU
[(2R)-4-(2-azanyl-6-oxidanylidene-3H-purin-9-yl)-2..
A 100.0
/96.2
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[1] G 1RP
6-fluoro-3-oxo-4-(5-O-phosphono-beta-D-ribofuranos..
C 100.0
/96.4
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
7dfh[1] N RVP
RIBAVIRIN MONOPHOSPHATE[20 atoms]
A 100.0
/96.4
9
/9
R1AB_SARS2 RNA-directed RNA polymeras
7uob[1] L GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7uob[4] M GTP
GUANOSINE-5'-TRIPHOSPHATE[32 atoms]
A 100.0
/96.3
19
/19
R1AB_SARS2 RNA-directed RNA polymerase
7uob[2] N L2B
3'-DEOXYURIDINE-5'-MONOPHOSPHATE[19 atoms]
A 100.0
/96.3
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7uoe[1] K CTP
CYTIDINE-5'-TRIPHOSPHATE[29 atoms]
A 100.0
/96.3
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
8sqj[2] I VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan..
A 100.0
/96.3
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
8sqk[1] J VSN
5'-O-[(R)-hydroxy(thiophosphonooxy)phosphoryl]guan..
A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase nsp12
7uo4[1] G NWX
[[(2~{R},3~{S},4~{R},5~{R})-5-(4-azanylpyrrolo[2,1..
A 100.0
/96.3
17
/17
R1AB_SARS2 RNA-directed RNA polymerase
7cyq[1] L GDP
GUANOSINE-5'-DIPHOSPHATE[28 atoms]
A 100.0
/96.3
8
/8
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] J AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/96.3
16
/16
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] K AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/96.3
11
/11
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] N AT9
[[(2R,3R,4R,5R)-5-(2-azanyl-6-oxidanylidene-1H-pur..
A 100.0
/96.3
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
7uo7[1] G ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms]
A 100.0
/96.3
14
/14
R1AB_SARS2 RNA-directed RNA polymerase
7uo9[1] J UTP
URIDINE 5'-TRIPHOSPHATE [29 atoms]
A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
8gw1[2] T U5P
URIDINE-5'-MONOPHOSPHATE[20 atoms]
A 100.0
/96.2
8
/8
R1AB_SARS2 Replicase polyprotein 1ab
8gwe[3] M GNP
PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER[32 ato..
A 100.0
/96.3
13
/13
R1AB_SARS2 RNA-directed RNA polymerase
8sq9[1] L WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph..
A 100.0
/96.3
15
/15
R1AB_SARS2 RNA-directed RNA polymerase
8sq9[1] O WSB
5'-O-[(S)-hydroxy{[(S)-hydroxy(phosphonooxy)phosph..
A 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7d4f[1] G H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
7d4f[1] H H3U
8-(3-(3-aminobenzamido)-4-methylbenzamido)naphthal..
D 100.0
/96.3
12
/12
R1AB_SARS2 RNA-directed RNA polymerase
5sl0[1] G B0V
2-methoxy-~{N}-(2,4,6-trimethylphenyl)ethanamide[1..
A 100.0
/95.8
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl0[1] H B0V
2-methoxy-~{N}-(2,4,6-trimethylphenyl)ethanamide[1..
A 100.0
/95.8
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sly[1] G LM6
1-(1-ethyl-1H-pyrazol-5-yl)-N-methylmethanamine[10..
A 100.0
/95.8
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl6[1] G 60P
3-methylthiophene-2-carboxylic acid[9 atoms]
A 100.0
/95.8
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl6[1] H 60P
3-methylthiophene-2-carboxylic acid[9 atoms]
A 100.0
/95.8
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] G LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms]..
A 100.0
/95.8
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] H LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms]..
A 100.0
/95.8
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sli[1] I LL0
2-(difluoromethoxy)benzene-1-sulfonamide[14 atoms]..
A 100.0
/95.8
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sln[1] G LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18..
A 100.0
/95.8
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slx[1] G LMW
2-[(4-aminophenyl)(ethyl)amino]ethan-1-ol[13 atoms..
A 100.0
/95.8
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slx[1] H LMW
2-[(4-aminophenyl)(ethyl)amino]ethan-1-ol[13 atoms..
A 100.0
/95.8
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slo[1] G JJM
1-methyl-N-(3-methylphenyl)-1H-pyrazolo[3,4-d]pyri..
A 100.0
/95.8
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slp[1] G UWY
N-(1-ethyl-1H-pyrazol-4-yl)cyclopentanecarboxamide..
A 100.0
/95.7
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5rl6[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
B 100.0
/99.8
9
/9
R1AB_SARS2 Helicase
5slf[1] G LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
A 100.0
/95.7
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slf[1] H LJA
N-[3-(carbamoylamino)phenyl]acetamide[14 atoms]
A 100.0
/95.7
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5rmk[1] H O2A
N-methyl-1H-indole-7-carboxamide[13 atoms]
B 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
5sl1[1] G O2A
N-methyl-1H-indole-7-carboxamide[13 atoms]
A 87.5
/95.7
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl2[1] G LFO
N,1-dimethyl-1H-indole-3-carboxamide[14 atoms]
A 87.5
/95.7
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slj[1] G LKU
3-fluoro-N-(3-hydroxy-4-methylphenyl)benzamide[18 ..
A 91.7
/95.7
12
/12
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slm[1] G WN1
N-(2-fluorophenyl)-3-methoxybenzamide[18 atoms]
A 90.9
/95.7
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm4[1] G AWD
~{N}-(4-fluorophenyl)-4-methyl-piperazine-1-carbox..
A 90.0
/95.7
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm9[1] G VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4..
A 91.7
/95.7
12
/12
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sma[1] G NZD
4-methyl-N-phenylpiperazine-1-carboxamide[16 atoms..
A 90.0
/95.7
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smc[1] G LRF
N~2~-(4-cyano-3-methyl-1,2-thiazol-5-yl)-N~2~-meth..
A 100.0
/95.7
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smc[1] H LRF
N~2~-(4-cyano-3-methyl-1,2-thiazol-5-yl)-N~2~-meth..
A 87.5
/95.7
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sme[1] G I8D
(4-chlorophenyl)(thiomorpholin-4-yl)methanone[15 a..
A 100.0
/95.7
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5rm9[1] H EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..
B 100.0
/99.8
10
/10
R1AB_SARS2 Helicase
5slv[1] G EJQ
~{N}-(4-fluorophenyl)-2-pyrrolidin-1-yl-ethanamide..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[1] B LF6
{(1R,2R)-2-[(Z)-(3-methyl-1,2,4-thiadiazol-5(2H)-y..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skx[1] B T6J
2-[(methylsulfonyl)methyl]-1H-benzimidazole[14 ato..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sky[1] G O2M
N-[(4-methyl-1,3-thiazol-2-yl)methyl]-1H-pyrazole-..
A 100.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skz[1] G NVD
N-{[4-(dimethylamino)phenyl]methyl}-4H-1,2,4-triaz..
A 100.0
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl3[1] G LGR
2-[acetyl(methyl)amino]benzoic acid[14 atoms]
A 70.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl4[1] G LHR
N-(1H-indazol-6-yl)acetamide[13 atoms]
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl4[1] H LHR
N-(1H-indazol-6-yl)acetamide[13 atoms]
A 100.0
/95.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl5[1] G WNV
N,N,2,3-tetramethylbenzamide[13 atoms]
A 87.5
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl7[1] G W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-..
A 83.3
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl8[1] G JGD
N,N-dimethylpyridin-4-amine[9 atoms]
A 100.0
/95.6
3
/3
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sl9[1] G O0S
N-{4-[(pyrimidin-2-yl)oxy]phenyl}acetamide[17 atom..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sla[1] G LJR
1-cyclohexyl-N-methylmethanesulfonamide[12 atoms]
A 100.0
/95.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sla[1] H LJR
1-cyclohexyl-N-methylmethanesulfonamide[12 atoms]
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slb[1] G LJK
3-methyl-N-(2-methylbutan-2-yl)-1H-pyrazole-5-carb..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slc[1] G U1V
1-(4-fluoro-2-methylphenyl)methanesulfonamide[13 a..
A 100.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sld[1] G LJ6
(2R)-3-(3,5-dimethyl-1,2-oxazol-4-yl)-N,N,2-trimet..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sle[1] G JGA
N-ethyl-N'-(5-methyl-1,2-oxazol-3-yl)urea[12 atoms..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sle[1] H JGA
N-ethyl-N'-(5-methyl-1,2-oxazol-3-yl)urea[12 atoms..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slg[1] G NZJ
1-(3-methylbenzene-1-carbonyl)piperidine-4-carboxa..
A 100.0
/95.6
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slk[1] G LKL
2-[(5-chloro-3-fluoropyridin-2-yl)(methyl)amino]et..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sll[1] G LK6
N-[(3R)-3-methyl-1,1-dioxo-1lambda~6~-thiolan-3-yl..
A 100.0
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slq[1] G ELQ
[3,4-bis(fluoranyl)phenyl]-(4-methylpiperazin-1-yl..
A 85.7
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slr[1] G LO6
2-(difluoromethoxy)-1-[(2R,6S)-2,6-dimethylmorphol..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sls[1] G SZE
4-(3-fluoranylpyridin-2-yl)-1-methyl-piperazin-2-o..
A 66.7
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slt[1] G LNS
6-(methylcarbamoyl)pyridine-2-carboxylic acid[13 a..
A 75.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slw[1] G U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slw[1] H U0V
2-fluoro-N-[2-(pyridin-4-yl)ethyl]benzamide[18 ato..
A 100.0
/95.6
12
/12
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slz[1] G LQP
2-(difluoromethoxy)-1-[(3aR,6aS)-hexahydrocyclopen..
A 100.0
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm0[1] G LQI
(1-benzofuran-2-yl)(4-methylpiperidin-1-yl)methano..
A 100.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm1[1] G WH1
N-methyl-N-[2-(pyridin-2-yl)ethyl]benzamide[18 ato..
A 88.9
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm2[1] G LQ3
(5S)-5-(difluoromethoxy)pyridin-2(5H)-one[11 atoms..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm2[1] H LQ3
(5S)-5-(difluoromethoxy)pyridin-2(5H)-one[11 atoms..
A 100.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm3[1] G GT4
~{N}-(4-hydroxyphenyl)-2-methoxy-ethanamide[13 ato..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm5[1] G S5J
2-[4-(2-methoxyphenyl)piperazin-1-yl]ethanenitrile..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm6[1] G K1A
3-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]-5-methyl-..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm7[1] G LPU
1-(methanesulfonyl)piperidin-4-ol[11 atoms]
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5sm8[1] G WKA
N-(2,1,3-benzoxadiazol-4-yl)acetamide[13 atoms]
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smb[1] G LRR
1-(morpholin-4-yl)-4-phenylbutan-1-one[17 atoms]
A 100.0
/95.6
10
/10
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smd[1] G WKS
2,4-dimethyl-6-(piperazin-1-yl)pyrimidine[14 atoms..
A 100.0
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smf[1] G K1S
N,N-diethyl-5-methyl[1,2,4]triazolo[1,5-a]pyrimidi..
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smf[1] H K1S
N,N-diethyl-5-methyl[1,2,4]triazolo[1,5-a]pyrimidi..
A 100.0
/95.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smg[1] G LR9
3-amino-N-ethyl-N-methylbenzamide[13 atoms]
A 100.0
/95.6
9
/9
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smh[1] G 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami..
A 100.0
/95.6
7
/7
R1AB_SARS2 Proofreading exoribonuclease nsp14
5smi[1] G LQV
(2S)-N-(5-methylpyridin-2-yl)oxolane-2-carboxamide..
A 100.0
/95.6
8
/8
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slh[1] G LLU
(2S)-2-(2-fluorophenoxy)propanoic acid[13 atoms]
A 100.0
/95.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
7qif[1] B GTG
7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE[52..
A 100.0
/95.6
14
/14
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slu[1] G UX1
1-[(2-fluorophenyl)methyl]-N-methylcyclopropane-1-..
A 100.0
/95.6
6
/6
R1AB_SARS2 Proofreading exoribonuclease nsp14
5slu[1] H UX1
1-[(2-fluorophenyl)methyl]-N-methylcyclopropane-1-..
A 100.0
/95.6
11
/11
R1AB_SARS2 Proofreading exoribonuclease nsp14
5c8s[4] K SAH
S-ADENOSYL-L-HOMOCYSTEINE[26 atoms]
B 100.0
/100.0
14
/14
R1AB_CVHSA Guanine-N7 methyltransferase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2a5a[2] B CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like peptidase
3e9s[1] D CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA Non-structural protein 3
3e9s[1] E CL
CHLORIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA Non-structural protein 3
7lfv[1] FA CL
CHLORIDE ION[1 atoms]
B 100.0
/100.0
1
/1
R1A_SARS papain-like protease
2fe8[6] E BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] F BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] G BR
BROMIDE ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2z9g[2] B HG
MERCURY (II) ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA 3C-like proteinase
4m0w[1] D NA
SODIUM ION[1 atoms]
A 80.0
/99.7
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] C NA
SODIUM ION[1 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] D NA
SODIUM ION[1 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] E NA
SODIUM ION[1 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] F NA
SODIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA Replicase polyprotein 1a
5y3e[2] G NA
SODIUM ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_CVHSA Replicase polyprotein 1a
7lfv[1] DA NH4
AMMONIUM ION[1 atoms]
B 100.0
/100.0
2
/2
R1A_SARS papain-like protease
5e6j[1] H NI
NICKEL (II) ION[1 atoms]
A 50.0
/99.1
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
5c8s[16] J MG
MAGNESIUM ION[1 atoms]
B 100.0
/100.0
3
/3
R1AB_CVHSA Guanine-N7 methyltransferase
6xez[26] K MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.3
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
6xez[19] T MG
MAGNESIUM ION[1 atoms]
E 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
6xqb[22] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/97.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[2] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.3
2
/2
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] L MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7egq[2] HA MG
MAGNESIUM ION[1 atoms]
H 100.0
/95.0
4
/4
R1AB_SARS2 Proofreading exoribonuclease
8gwe[1] N MG
MAGNESIUM ION[1 atoms]
A 100.0
/96.3
1
/1
R1AB_SARS2 RNA-directed RNA polymerase
7thm[5] H MN
MANGANESE (II) ION[1 atoms]
A 100.0
/96.9
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7lcp[2] D CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS 3C-like proteinase
7lcp[2] E CA
CALCIUM ION[1 atoms]
A 100.0
/100.0
3
/3
R1AB_SARS 3C-like proteinase
7n0b[2] G CA
CALCIUM ION[1 atoms]
B 100.0
/94.9
3
/3
R1AB_SARS2 Proofreading exoribonuclease
2fe8[17] D ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2z94[13] B ZN
ZINC ION[1 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA Replicase polyprotein 1ab
3e9s[5] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA Non-structural protein 3
5c8s[13] G ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[13] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8s[13] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] H ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5c8t[4] I ZN
ZINC ION[1 atoms]
B 100.0
/100.0
4
/4
R1AB_CVHSA Guanine-N7 methyltransferase
5nfy[4] I ZN
ZINC ION[1 atoms]
A 100.0
/99.8
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] J ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
Q1T6X8_CVHSA Polyprotein 1ab
5nfy[4] K ZN
ZINC ION[1 atoms]
A 100.0
/99.8
5
/5
Q1T6X8_CVHSA Polyprotein 1ab
5rl6[146] C ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rl6[134] D ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5rl6[134] E ZN
ZINC ION[1 atoms]
A 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
5skw[62] E ZN
ZINC ION[1 atoms]
A 100.0
/95.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] F ZN
ZINC ION[1 atoms]
A 100.0
/95.6
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] G ZN
ZINC ION[1 atoms]
A 80.0
/95.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5tl6[7] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
5wwp[11] C ZN
ZINC ION[1 atoms]
A 100.0
/72.3
4
/4
K0BWD0_9BETC ORF1ab
6nur[4] E ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA NSP12
6nur[4] F ZN
ZINC ION[1 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA NSP12
6xez[41] I ZN
ZINC ION[1 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6xez[41] J ZN
ZINC ION[1 atoms]
A 100.0
/96.3
6
/6
R1AB_SARS2 RNA-directed RNA polymerase
6xez[20] O ZN
ZINC ION[1 atoms]
E 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
6xez[22] P ZN
ZINC ION[1 atoms]
E 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
6xez[20] Q ZN
ZINC ION[1 atoms]
E 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
6xqb[8] G ZN
ZINC ION[1 atoms]
A 100.0
/97.3
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
6xqb[8] H ZN
ZINC ION[1 atoms]
A 100.0
/97.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
6yyt[6] I ZN
ZINC ION[1 atoms]
A 100.0
/96.8
4
/4
R1AB_SARS2 nsp12
6yyt[6] J ZN
ZINC ION[1 atoms]
A 100.0
/96.8
4
/4
R1AB_SARS2 nsp12
7bw4[1] E ZN
ZINC ION[1 atoms]
A 100.0
/96.9
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7bw4[1] F ZN
ZINC ION[1 atoms]
A 100.0
/96.9
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] G ZN
ZINC ION[1 atoms]
A 100.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7ed5[1] H ZN
ZINC ION[1 atoms]
A 100.0
/96.3
5
/5
R1AB_SARS2 RNA-directed RNA polymerase
7fac[1] C ZN
ZINC ION[1 atoms]
A 100.0
/100.0
7
/7
R1A_SARS Non-structural protein 2
7msw[2] B ZN
ZINC ION[1 atoms]
A 100.0
/68.3
5
/5
R1AB_SARS2 Non-structural protein 2
7r2v[2] I ZN
ZINC ION[1 atoms]
A 100.0
/95.0
2
/2
R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[2] J ZN
ZINC ION[1 atoms]
A 100.0
/95.0
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
7skq[1] H ZN
ZINC ION[1 atoms]
A 100.0
/97.8
2
/2
Q0QDZ2_SARS 3C-like proteinase
7skr[2] E ZN
ZINC ION[1 atoms]
A 66.7
/97.8
3
/3
Q0QDZ2_SARS 3C-like proteinase
8g6r[1] F ZN
ZINC ION[1 atoms]
A 100.0
/60.5
4
/4
A0A0U2C263_9ALPC nsp12
8g6r[1] G ZN
ZINC ION[1 atoms]
A 100.0
/60.5
4
/4
A0A0U2C263_9ALPC nsp12
8urb[1] G ZN
ZINC ION[1 atoms]
A 100.0
/60.3
4
/4
U6BRU0_9ALPC nsp12
8urb[1] H ZN
ZINC ION[1 atoms]
A 100.0
/60.3
4
/4
U6BRU0_9ALPC nsp12
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1uj1[200] B R1AB_CVHSA 3C-like proteinase[302 aa] A 100.0
/100.0
29
/29
R1AB_CVHSA 3C-like proteinase
2gtb[2] A R1AB_CVHSA 3C-like proteinase[299 aa] A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like proteinase
2z3e[2] A R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)[306 aa] A 100.0
/100.0
5
/5
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3iwm[4] A R1A_CVHSA 3C-like proteinase[301 aa] A 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
3iwm[8] B R1A_CVHSA 3C-like proteinase[301 aa] A 100.0
/100.0
1
/1
R1A_CVHSA 3C-like proteinase
3iwm[8] C R1A_CVHSA 3C-like proteinase[300 aa] A 100.0
/100.0
72
/72
R1A_CVHSA 3C-like proteinase
3iwm[8] D R1A_CVHSA 3C-like proteinase[300 aa] A 100.0
/100.0
3
/3
R1A_CVHSA 3C-like proteinase
3iwm[8] D R1A_CVHSA 3C-like proteinase[300 aa] A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
6xez[18] F R1AB_SARS2 Helicase[596 aa] E 100.0
/99.8
4
/4
R1AB_SARS2 Helicase
6xez[10] E R1AB_SARS2 Helicase[596 aa] F 100.0
/99.8
5
/5
R1AB_SARS2 Helicase
7cxm[2] H R1AB_SARS2 Helicase[596 aa] I 100.0
/99.8
3
/3
R1AB_SARS2 Helicase
7cyq[9] G R1AB_SARS2 Helicase[585 aa] H 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
7nio[2] B R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa] A 100.0
/99.8
14
/14
R1AB_SARS2 SARS-CoV-2 helicase NSP13
7rdx[3] E R1AB_SARS2 Helicase[590 aa] F 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
7re0[1] F R1AB_SARS2 Helicase[590 aa] E 100.0
/99.8
6
/6
R1AB_SARS2 Helicase
8gw1[1] H R1AB_SARS2 Helicase[585 aa] G 100.0
/99.8
1
/1
R1AB_SARS2 Helicase
2h85[12] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 100.0
/99.4
28
/28
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 96.3
/99.4
27
/27
Q6VA80_CVHSA Putative orf1ab polyprotein
2h85[6] A Q6VA80_CVHSA Putative orf1ab polyprotein[347 aa] A 100.0
/99.4
15
/16
Q6VA80_CVHSA Putative orf1ab polyprotein
2rhb[6] B R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] A 100.0
/99.7
25
/25
R1AB_CVHSA Uridylate-specific endoribonuclease
2rhb[6] E R1AB_CVHSA Uridylate-specific endoribonuclease[346 aa] A 100.0
/99.7
16
/17
R1AB_CVHSA Uridylate-specific endoribonuclease
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 100.0
/100.0
23
/23
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[6] B R1AB_CVHSA Replicase polyprotein 1ab[314 aa] A 100.0
/100.0
8
/9
R1AB_CVHSA Replicase polyprotein 1ab
2fe8[7] C R1AB_CVHSA Replicase polyprotein 1ab[313 aa] A 100.0
/100.0
18
/18
R1AB_CVHSA Replicase polyprotein 1ab
7skq[1] B Q0QDZ2_SARS 3C-like proteinase[304 aa] A 100.0
/97.8
20
/20
Q0QDZ2_SARS 3C-like proteinase
7skr[2] A Q0QDZ2_SARS 3C-like proteinase[314 aa] A 100.0
/97.8
27
/27
Q0QDZ2_SARS 3C-like proteinase
7egq[2] I R1AB_SARS2 RNA-directed RNA polymerase[926 aa] A 75.0
/96.3
4
/4
R1AB_SARS2 RNA-directed RNA polymerase
7re3[2] J R1AB_SARS2 RNA-directed RNA polymerase[927 aa] A 77.8
/96.3
9
/9
R1AB_SARS2 RNA-directed RNA polymerase
7n0d[2] D R1AB_SARS2 Proofreading exoribonuclease[512 aa] B 77.8
/94.7
9
/9
R1AB_SARS2 Proofreading exoribonuclease
7n0d[4] K R1AB_SARS2 Proofreading exoribonuclease[512 aa] B 100.0
/94.7
14
/14
R1AB_SARS2 Proofreading exoribonuclease
7n0d[2] B R1AB_SARS2 Proofreading exoribonuclease[512 aa] D 100.0
/94.7
11
/11
R1AB_SARS2 Proofreading exoribonuclease
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
7073 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
2a5a[15] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like peptidase
3vb3[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb3[5] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
3vb3[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
3vb3[3] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb3[3] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
3vb3[1] I EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1A_CVHSA 3C-like proteinase
3vb4[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb4[2] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb4[3] I EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3vb4[1] L EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
3vb7[1] G EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
5
/5
R1A_CVHSA 3C-like proteinase
7lcp[4] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
2
/2
R1AB_SARS 3C-like proteinase
7lcq[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
7
/7
R1AB_SARS 3C-like proteinase
7lcq[2] C EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
1
/1
R1AB_SARS 3C-like proteinase
7lfv[1] F EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS papain-like protease
7lfv[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[1] I EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS papain-like protease
7lfv[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[1] K EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS papain-like protease
7lfv[1] M EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_SARS papain-like protease
7lfv[1] N EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[2] O EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[2] Q EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/100.0
5
/5
R1A_SARS papain-like protease
7lfv[1] BA EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
4
/4
R1A_SARS papain-like protease
7lfv[1] T EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1A_SARS papain-like protease
7lfv[1] V EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
2
/2
R1A_SARS papain-like protease
7lfv[1] X EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1A_SARS papain-like protease
7lfv[2] Y EDO
1,2-ETHANEDIOL[4 atoms]
B 100.0
/100.0
3
/3
R1A_SARS papain-like protease
2a5i[14] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like peptidase
2z3e[2] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab (pp1ab)
3vb4[1] K GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
3vb7[1] H GOL
GLYCEROL[6 atoms]
B 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
4m0w[1] G GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
5
/5
R1A_CVHSA Replicase polyprotein 1a
4m0w[3] H GOL
GLYCEROL[6 atoms]
A 100.0
/99.7
6
/6
R1A_CVHSA Replicase polyprotein 1a
4ow0[1] F GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
3
/3
R1A_CVHSA papain-like protease
5y3e[2] I GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
5y3e[1] J GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA Replicase polyprotein 1a
7lmg[8] B GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
8
/8
R1A_SARS 3C-like proteinase
7lmg[4] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
1
/1
R1A_SARS 3C-like proteinase
7lmh[6] D GOL
GLYCEROL[6 atoms]
A 100.0
/100.0
6
/6
R1A_SARS 3C-like proteinase
2fe8[7] H SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA Replicase polyprotein 1ab
2v6n[2] D SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
5tl6[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
3
/3
R1AB_CVHSA Replicase polyprotein 1ab
5wwp[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/72.3
5
/5
K0BWD0_9BETC ORF1ab
7lfv[1] R SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
2
/2
R1A_SARS papain-like protease
7lfv[1] S SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
4
/4
R1A_SARS papain-like protease
2gt7[1] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
B 100.0
/100.0
1
/1
R1AB_CVHSA 3C-like proteinase
2v6n[8] C MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA REPLICASE POLYPROTEIN 1AB
6w79[4] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/100.0
3
/3
Main protease
2gtb[2] C ACY
ACETIC ACID[4 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like proteinase
2z9g[2] C BNZ
BENZENE[6 atoms]
A 100.0
/100.0
7
/7
R1AB_CVHSA 3C-like proteinase
2z9j[2] E DTZ
zinc(II)hydrogensulfide[3 atoms]
A 100.0
/100.0
4
/4
R1AB_CVHSA 3C-like proteinase
2z9k[2] E DOZ
(dimethylamino)(hydroxy)zinc'[5 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like proteinase
2z9l[2] E DAZ
diaminozinc[3 atoms]
A 100.0
/100.0
2
/2
R1AB_CVHSA 3C-like proteinase
3snd[1] E MRD
(4R)-2-METHYLPENTANE-2,4-DIOL[8 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA 3C-like proteinase
5y3q[1] C BME
BETA-MERCAPTOETHANOL[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA Replicase polyprotein 1a
7k0h[1] G PG4
TETRAETHYLENE GLYCOL[13 atoms]
B 100.0
/100.0
10
/10
R1A_CVHSA Replicase polyprotein 1a
6xez[18] S AF3
ALUMINUM FLUORIDE[4 atoms]
E 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5e6j[1] G ACT
ACETATE ION[4 atoms]
A 100.0
/99.1
6
/6
R1AB_CVHSA Replicase polyprotein 1ab
2vj1[1] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2vj1[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2vj1[1] F DMS
DIMETHYL SULFOXIDE[4 atoms]
B 100.0
/100.0
3
/3
A7J8L3_CVHSA SARS CORONAVIRUS MAIN PROTEINASE
2z9j[6] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1AB_CVHSA 3C-like proteinase
2z9j[6] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
9
/9
R1AB_CVHSA 3C-like proteinase
2z9j[6] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1AB_CVHSA 3C-like proteinase
3snc[14] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1A_CVHSA 3C-like proteinase
3tiu[2] B DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
6
/6
R1A_CVHSA SARS coronavirus main protease
3v3m[4] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
8
/8
R1A_CVHSA 3C-like proteinase
4ovz[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA Papain-like proteinase
4ow0[1] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1A_CVHSA papain-like protease
6y7m[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1A_SARS 3C-like proteinase
7rc1[2] D DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
8
/8
R1A_SARS 3C-like proteinase
7rc1[2] E DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
5
/5
R1A_SARS 3C-like proteinase
7rc1[2] F DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
2
/2
R1A_SARS 3C-like proteinase
7rc1[2] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
3
/3
R1A_SARS 3C-like proteinase
7rc1[2] G DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/100.0
1
/1
R1A_SARS 3C-like proteinase
7skr[2] C DMS
DIMETHYL SULFOXIDE[4 atoms]
A 100.0
/97.8
2
/2
Q0QDZ2_SARS 3C-like proteinase
7aap[2] K POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/96.3
7
/7
R1AB_SARS2 Non-structural protein 12
7bv2[5] H POP
PYROPHOSPHATE 2-[9 atoms]
A 100.0
/96.8
3
/3
R1AB_SARS2 RNA-directed RNA polymerase
7dfg[4] M POP
PYROPHOSPHATE 2-[9 atoms]
C 100.0
/96.4
7
/7
R1AB_SARS2 RNA-directed RNA polymerase
5rl6[216] F PO4
PHOSPHATE ION[5 atoms]
A 100.0
/99.8
7
/7
R1AB_SARS2 Helicase
5skw[62] C PO4
PHOSPHATE ION[5 atoms]
A 100.0
/95.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
5skw[62] D PO4
PHOSPHATE ION[5 atoms]
A 100.0
/95.6
5
/5
R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] E TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 100.0
/95.0
2
/2
R1AB_SARS2 Proofreading exoribonuclease nsp14
3vb3[2] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
4
/4
R1A_CVHSA 3C-like proteinase
5nfy[2] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/99.8
2
/2
Q1T6X8_CVHSA Polyprotein 1ab
7lmg[4] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
2
/2
R1A_SARS 3C-like proteinase
7lmg[4] E PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
1
/1
R1A_SARS 3C-like proteinase
7lmj[2] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
3
/3
R1A_SARS 3C-like proteinase
7r2v[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/95.0
4
/4
R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/95.0
3
/3
R1AB_SARS2 Proofreading exoribonuclease nsp14
7r2v[1] N PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
B 100.0
/95.0
1
/1
R1AB_SARS2 Proofreading exoribonuclease nsp14
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.