Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
4050931 365 500 P04439(HLAA_HUMAN) RecName: Full=HLA class I histocompatibility antigen, A alpha chain;AltName: Full=Human leukocyte antigen A; Short=HLA-A;Flags: Precursor;
QUERYSEQ
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
NEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P04439(HLAA_HUMAN)]

365
region name description
1-24 SIGNAL
25-365 CHAIN /note="HLA class I histocompatibility antigen, A alpha chain" /id="PRO_0000018815"
25-308 TOPO_DOM /note="Extracellular"
309-332 TRANSMEM /note="Helical"
333-365 TOPO_DOM /note="Cytoplasmic"
209-295 DOMAIN /note="Ig-like C1-type"
3-11 REGION /note="VL9 epitope"
25-114 REGION /note="Alpha-1"
115-206 REGION /note="Alpha-2"
207-298 REGION /note="Alpha-3"
299-308 REGION /note="Connecting peptide"
339-365 REGION /note="Disordered"
341-359 COMPBIAS /note="Polar residues"
31-31 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
97-97 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
108-108 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
140-140 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen"
167-167 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
170-170 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
183-183 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
183-183 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="2" /ligand_note="self-peptide antigen"
195-195 BINDING /ligand="a peptide antigen" /ligand_id="ChEBI:CHEBI:166823" /ligand_label="1" /ligand_note="pathogen-derived peptide antigen"
1-365 DISORDER predicted by DISOPRED

MONOMER
365
pdb_id a1 identity[%]2 description
6o9c A 99.6 1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha chain
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1qvo[3] C NEF_HV1Z6 Negative factor[10 aa] A 89.3
/97.5
28
/28
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
2xpg[1] C MYPR_HUMAN MYELIN PROTEOLIPID PROTEIN[9 aa] A 100.0
/100.0
26
/26
1A03_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA ..
5wkf[9] E D30 TCR beta chain[244 aa] A 100.0
/97.4
10
/10
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
6eny[1] B TPSN_HUMAN Tapasin[364 aa] D 100.0
/100.0
11
/11
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6eny[1] E CALR_HUMAN Calreticulin[365 aa] D 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd[1] E CALR_HUMAN Calreticulin[364 aa] D 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7l1b[1] C PK3CA_HUMAN wild-type PIK3CA peptide[9 aa] A 100.0
/100.0
24
/24
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c[3] C PK3CA_HUMAN mutant PIK3CA peptide[9 aa] A 100.0
/100.0
28
/28
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d[1] D T cell receptor, alpha chain[187 aa] A 100.0
/100.0
6
/6
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1d[1] E T cell receptor, beta chain[247 aa] A 100.0
/100.0
12
/12
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mle[1] C NCAP_INBAC Nucleoprotein peptide[9 aa] A 100.0
/100.0
25
/25
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7ow3[3] C RASN_HUMAN KRAS peptide (VVVGAGGVGK)[10 aa] A 87.0
/97.4
23
/23
A0A583ZB34_HUMAN MHC class I antigen
8dvg[1] C VAL-VAL-VAL-GLY-ALA-GLY-GLY-VAL-GLY-LYS[10 aa] A 100.0
/100.0
23
/23
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd[1] B TPSN_HUMAN Tapasin[348 aa] D 100.0
/100.0
26
/26
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd[1] C PDIA3_HUMAN Protein disulfide-isomerase A3[459 aa] D 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7rrg[1] C T cell receptor, alpha chain[185 aa] A 100.0
/100.0
10
/10
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf[1] A IgG, Fab Heavy Chain V2[216 aa] D 100.0
/100.0
16
/16
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf[1] B KRAS G12V (7-16)[10 aa] D 100.0
/100.0
19
/19
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7stf[1] C IgG, Fab Light Chain V2[214 aa] D 100.0
/100.0
8
/8
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7uc5[2] C NCAP_I46A1 Nucleoprotein peptide[9 aa] A 100.0
/100.0
30
/30
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
6o9c[1] C CTNB1_HUMAN Catenin beta-1[9 aa] A 100.0
/99.6
23
/23
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9b[1] C CTNB1_HUMAN Catenin beta-1[9 aa] A 100.0
/99.6
22
/22
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7m8t[1] C SPIKE_SARS2 Spike protein S1 peptide[9 aa] A 88.0
/97.5
25
/25
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
4uq2[2] F AZOBENZENE-CONTAINING PEPTIDE[7 aa] A 76.9
/97.5
13
/13
1A11_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-11 ALPHA..
6id4[2] G Heavy chain[216 aa] A 100.0
/97.4
10
/10
F6IQY1_HUMAN MHC class I antigen
6id4[2] H Light chain[216 aa] A 75.0
/97.4
4
/4
F6IQY1_HUMAN MHC class I antigen
7ow6[1] D TCR alpha[181 aa] A 91.7
/97.5
12
/12
A0A583ZB34_HUMAN MHC class I antigen
7s8r[2] C M1_INBAC Matrix protein 1 peptide SALEWIKNK[9 aa] A 84.6
/97.5
26
/26
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
1x7q[2] C NCAP_CVHSA SARS NUCLEOCAPSID PEPTIDE[9 aa] A 89.7
/97.5
29
/29
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
2hn7[1] C DNA polymerase PEPTIDE HOMOLOGUE[10 aa] A 88.0
/97.4
25
/25
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
4mj5[1] C R4P6M5_9INFA Nucleocapsid protein[11 aa] A 85.2
/97.4
27
/27
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
4mj6[1] C R4X2K3_9INFA Nucleoprotein[11 aa] A 84.0
/97.4
25
/25
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
4n8v[2] A KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2[190 .. C 100.0
/97.4
11
/11
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
4n8v[2] E A14_VACCW peptide from Virion membrane protein A14[9 aa] C 86.7
/97.4
30
/30
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5grd[1] C Epstein Barr Virus, Latent membrane protein 2 epit.. A 84.6
/97.4
26
/26
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5grg[1] C Epstein Barr Virus, Latent Membrane Protein 2 epit.. A 84.6
/97.4
13
/13
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5grg[1] D Epstein Barr Virus, Latent Membrane Protein 2 epit.. A 81.8
/97.4
11
/11
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5gsd[1] C Epstein Barr Virus, Latent membrane protein-2 epit.. A 88.9
/97.4
18
/18
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5wjl[5] C GTS1 peptide[10 aa] A 92.6
/97.4
27
/27
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5wjn[5] C GTS3 peptide[10 aa] A 86.7
/97.4
30
/30
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
5wkf[4] D A0A087WSZ9_HUMAN K7N5N2_HUMAN T-cell receptor alpha variable 30,T-cell receptor,.. A 75.0
/97.4
4
/4
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
6joz[1] C ALA-THR-ILE-GLY-THR-ALA-MET-TYR-LYS[9 aa] A 85.2
/97.4
27
/27
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
6jp3[1] C ALA-THR-ILE-GLY-THR[5 aa] A 76.9
/97.4
13
/13
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
6jp3[1] D ALA-MET-TYR-LYS[4 aa] A 84.6
/97.4
13
/13
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
7ow3[1] F RASN_HUMAN KRAS peptide (VVVGAGGVGK)[7 aa] D 91.3
/97.4
23
/23
A0A583ZB34_HUMAN MHC class I antigen
7ow3[1] I RASN_HUMAN KRAS peptide (VVVGAGGVGK)[6 aa] G 90.9
/97.4
22
/22
A0A583ZB34_HUMAN MHC class I antigen
7ow4[4] C RASN_HUMAN KRAS G12D peptide (VVVGADGVGK)[8 aa] A 90.9
/97.5
22
/22
A0A583ZB34_HUMAN MHC class I antigen
7ow5[1] D TCR alpha[191 aa] A 91.7
/97.4
12
/12
A0A583ZB34_HUMAN MHC class I antigen
7ow5[4] E TCR beta[246 aa] A 100.0
/97.4
5
/5
A0A583ZB34_HUMAN MHC class I antigen
7ow6[3] C RASN_HUMAN KRAS G12D peptide (VVVGADGVGK)[10 aa] A 88.5
/97.5
26
/26
A0A583ZB34_HUMAN MHC class I antigen
7pb2[2] D TCR alpha[163 aa] A 90.0
/97.4
10
/10
A0A583ZB34_HUMAN MHC class I antigen
7s8q[2] C NCAP_INBSI Nucleoprotein peptide KTNGNAFIGK[10 aa] A 85.7
/97.5
28
/28
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7s8s[1] C NS1_INBSJ Non-structural protein 1 peptide RVLVNGTFLK[10 aa].. A 87.1
/97.4
31
/31
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
8i5c[11] C peptide KRAS-G12V-9[9 aa] A 81.8
/96.7
22
/22
U5YJJ6_HUMAN MHC class I antigen (Fragment)
8i5c[10] D TCR alpha chain[198 aa] A 88.9
/96.7
9
/9
U5YJJ6_HUMAN MHC class I antigen (Fragment)
8i5c[10] E TCR beta chain[240 aa] A 100.0
/96.7
10
/10
U5YJJ6_HUMAN MHC class I antigen (Fragment)
8i5d[1] A TCR alpha chain[194 aa] C 84.6
/96.7
13
/13
U5YJJ6_HUMAN MHC class I antigen (Fragment)
8i5d[1] B TCR beta chain[242 aa] C 100.0
/96.7
7
/7
U5YJJ6_HUMAN MHC class I antigen (Fragment)
8i5e[1] C RASK_HUMAN KRAS-G12wt-9[9 aa] A 88.0
/96.7
25
/25
U5YJJ6_HUMAN MHC class I antigen (Fragment)
1q94[7] C POL_HV1Z2 nonamer reverse transcriptase (AIFQSSMTK)[9 aa] A 86.2
/97.5
29
/29
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
6id4[2] J peptide[9 aa] A 85.2
/97.4
27
/27
F6IQY1_HUMAN MHC class I antigen
4nqv[7] M Nucleoprotein[9 aa] A 81.5
/94.5
27
/27
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
6j29[1] B MTB[9 aa] A 79.3
/96.0
29
/29
HLA-A*3003
4nqx[6] M NP44-S7N mutant peptide, CTELKLNDY[9 aa] A 75.0
/94.5
28
/28
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
1w72[3] C MAG1_HUMAN MELANOMA-ASSOCIATED ANTIGEN 1[9 aa] A 81.5
/94.5
27
/27
1A01_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
1w72[2] G HYB3 HEAVY CHAIN[223 aa] A 88.9
/94.5
9
/9
1A01_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
1w72[2] I HYB3 LIGHT CHAIN[210 aa] A 100.0
/94.5
6
/6
1A01_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
5brz[1] C GLU-VAL-ASP-PRO-ILE-GLY-HIS-LEU-TYR[9 aa] A 80.0
/94.5
25
/25
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
5brz[2] D A0A0B4J279_HUMAN TCA_HUMAN Protein TRAV21,T-cell receptor alpha chain C regio.. A 66.7
/94.5
9
/9
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
5brz[2] E A0A578_HUMAN K7N5M4_HUMAN Protein TRBV5-1,Human nkt tcr beta chain[241 aa] A 80.0
/94.5
5
/5
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
5bs0[1] C TITIN_HUMAN Titin[9 aa] A 78.3
/94.5
23
/23
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
6at9[1] C ALK[10 aa] A 74.1
/94.5
27
/27
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
6mpp[1] B NRAS Q61K peptide[10 aa] A 76.0
/94.5
25
/25
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
6ei2[1] C CCND2_HUMAN G1/S-specific cyclin-D2[10 aa] A 83.9
/94.2
31
/31
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
7tlt[2] E SPIKE_SARS2 Spike protein S1 peptide[9 aa] A 81.5
/94.2
27
/27
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
6pbh[1] C influenza A NP145-156 peptide[7 aa] A 79.2
/94.2
24
/24
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
1hsb[1] C BOUND PEPTIDE FRAGMENT[3 aa] A 75.0
/94.1
12
/12
1A68_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68.1)
1akj[493] B B2MG_HUMAN BETA 2-MICROGLOBULIN[98 aa] A 93.9
/93.1
33
/33
1A02_HUMAN MHC CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201..
3bh9[2] B B2MG_HUMAN Beta-2-microglobulin[100 aa] A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6eny[1] A B2MG_HUMAN Beta-2-microglobulin[99 aa] D 100.0
/100.0
3
/3
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7phr[1] G B2MG_HUMAN Beta-2-microglobulin[99 aa] F 93.9
/93.1
33
/33
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7tlt[5] B B2MG_HUMAN Beta-2-microglobulin[99 aa] A 93.9
/94.2
33
/33
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
1akj[7] C HIV REVERSE TRANSCRIPTASE EPITOPE[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN MHC CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201..
1akj[1] D CD8A_HUMAN T-CELL CORECEPTOR CD8[114 aa] A 100.0
/93.1
13
/13
1A02_HUMAN MHC CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201..
1akj[1] E CD8A_HUMAN T-CELL CORECEPTOR CD8[114 aa] A 100.0
/93.1
6
/6
1A02_HUMAN MHC CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201..
1b0g[4] C PEPTIDE P1049 (ALWGFFPVL)[9 aa] A 79.3
/93.1
29
/29
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN
1bd2[14] C TAX PEPTIDE[9 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA-A 0201
1bd2[1] D T CELL RECEPTOR ALPHA[190 aa] A 88.9
/93.1
9
/9
1A02_HUMAN HLA-A 0201
1bd2[18] E T CELL RECEPTOR BETA[242 aa] A 100.0
/93.1
4
/4
1A02_HUMAN HLA-A 0201
2f53[1] E T-cell receptor, beta chain[243 aa] A 75.0
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen
7q9b[1] E Human T Cell Receptor Mel8, Beta Chain[245 aa] F 93.8
/93.1
16
/16
U5YJM1_HUMAN MHC class I antigen
1duy[2] C HTLV-1 OCTAMERIC TAX PEPTIDE[8 aa] A 81.0
/93.1
21
/21
1A02_HUMAN HLA-A2*0201
1eey[2] C GP2 PEPTIDE[9 aa] A 84.6
/93.1
26
/26
1A02_HUMAN HLA-A2.1 MHC CLASS I (HEAVY CHAIN)
1eez[2] C GP2 PEPTIDE[9 aa] A 88.5
/93.1
26
/26
1A02_HUMAN HLA-A2.1 MHC CLASS I (HEAVY CHAIN)
1hhg[2] C ENV_HV1B8 HIV-1 GP120 ENVELOPE PROTEIN (RESIDUES 195-207)[9 .. A 79.2
/93.1
24
/24
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201) (A..
1hhh[1] C CORA_HBVIL HEPATITIS B NUCLEOCAPSID PROTEIN (RESIDUES 18-27)[.. A 79.3
/93.1
29
/29
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201) (A..
1hhi[13] C M1_IAPUE INFLUENZA A MATRIX PROTEIN M1 (RESIDUES 58-66)[9 a.. A 76.9
/93.1
26
/26
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A*0201) (A..
5euo[1] I M1_I34A1 Matrix protein 1[9 aa] C 76.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1i1f[2] C PROTEIN (HIV-RT VARIANT PEPTIDE I1F (FLKEPVHGV))[9.. A 80.8
/93.1
26
/26
1A02_HUMAN PROTEIN (CLASS I HISTOCOMPATIBILITY ANTIGEN, GOGO-..
1i1y[2] C HIV-RT VARIANT PEPTIDE I1Y (YLKEPVHGV)[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN
1i4f[1] C MAGA4_HUMAN MELANOMA-ASSOCIATED ANTIGEN 4[10 aa] A 82.6
/93.1
23
/23
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
8es8[2] K MAGA4_HUMAN Melanoma-associated antigen 4[10 aa] I 78.3
/93.1
23
/23
Q861F7_HUMAN MHC class I antigen
1i7r[2] C 9 RESIDUE PEPTIDE[9 aa] A 86.4
/93.1
22
/22
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1i7t[2] C 9 RESIDUE PEPTIDE[9 aa] A 87.5
/93.1
24
/24
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1i7u[2] C 9 RESIDUE PEPTIDE[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1im3[4] D US02_HCMVA cytomegalovirus protein US2[95 aa] A 92.3
/93.1
13
/13
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1lp9[2] D T-cell Receptor alpha chain[194 aa] A 91.7
/93.1
12
/12
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1lp9[2] E T-cell Receptor beta chain[237 aa] A 88.9
/93.1
9
/9
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1oga[6] D T-CELL RECEPTOR ALPHA CHAIN V REGION[200 aa] A 100.0
/93.1
3
/3
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
5euo[1] G PF6 TCR alpha chain[191 aa] C 83.3
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1oga[15] E TCB_HUMAN T-CELL RECEPTOR BETA CHAIN C REGION[241 aa] A 91.7
/93.1
12
/12
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
7phr[1] B T-cell receptor beta chain[285 aa] F 90.0
/93.1
10
/10
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
1p7q[5] D LIRB1_HUMAN leukocyte immunoglobulin-like receptor 1[183 aa] A 66.7
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1qew[1] C MAGA3_HUMAN PROTEIN (MELANOMA-ASSOCIATED ANTIGEN 3)[9 aa] A 87.5
/93.1
24
/24
1A02_HUMAN PROTEIN (HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, B..
1qr1[2] C ERBB2_HUMAN GP2 PEPTIDE[9 aa] A 81.8
/93.1
22
/22
1A02_HUMAN HLA-A2.1 HEAVY CHAIN
1s8d[1] C gag peptide[9 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t1w[5] C GAG PEPTIDE[9 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t1x[1] C GAG PEPTIDE[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t1y[1] C GAG PEPTIDE[9 aa] A 84.6
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t1z[1] C GAG PEPTIDE[9 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t20[3] C GAG PEPTIDE[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1t21[6] C GAG PEPTIDE[9 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvb[4] C PME17_HUMAN epitope of Melanocyte protein Pmel 17[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvh[4] C PME17_HUMAN epitope of Melanocyte protein Pmel 17[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2bnq[9] C SYNTHETIC PEPTIDE[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
6rp9[3] C CTG1B_HUMAN Cancer/testis antigen 1[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2bnq[6] D T-CELL RECEPTOR ALPHA CHAIN V REGION[203 aa] A 85.7
/93.1
7
/7
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
2bnr[5] C SYNTHETIC PEPTIDE[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN
2clr[2] C CRTC_HUMAN DECAMERIC PEPTIDE FROM CALRETICULIN[10 aa] A 78.6
/93.1
28
/28
1A02_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-A 0201) (A..
2git[3] C Transcriptional activator TAX[9 aa] A 85.2
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2gj6[7] D A6-Tcr[200 aa] A 91.7
/93.1
12
/12
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2gt9[6] C MAR1_HUMAN Melan-A/MART-1(26-35) peptide[10 aa] A 79.2
/93.1
24
/24
1A02_HUMAN HLA class I histocompatibility antigen
2gtw[2] C MAR1_HUMAN octapeptide from Melan-A/MART-1[9 aa] A 78.3
/93.1
23
/23
1A02_HUMAN HLA-A*0201 heavy chain
2gtz[2] C MAR1_HUMAN octapeptide from Melan-A/MART-1[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA-A*0201 heavy chain
2guo[8] C MAR1_HUMAN Peptide[9 aa] A 81.0
/93.1
21
/21
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6d78[1] C MAR1_HUMAN Melanoma antigen recognized by T-cells 1[9 aa] A 75.0
/93.1
20
/20
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2v2x[2] C HIV P17[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2x4n[2] C HLA-A2.1-RESTRICTED INFLUENZA A MATRIX EPITOPE[6 a.. A 81.8
/93.1
22
/22
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2x4o[2] C ENV_HV1MA ENVELOPE GLYCOPROTEIN GP160[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2x4p[4] C HLA-A2.1-RESTRICTED INFLUENZA A MATRIX EPITOPE[9 a.. A 76.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2.1
2x4r[2] C PP65_HCMVA 65 KDA PHOSPHOPROTEIN[9 aa] A 78.3
/93.1
23
/23
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2.1
2x4s[2] C H5N1 INFLUENZA A NUCLEOPROTEIN[9 aa] A 76.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2.1
2x4t[2] C PP65_HCMVA 65 KDA PHOSPHOPROTEIN[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2.1
2x70[2] C HLA-A2.1-RESTRICTED INFLUENZA A MATRIX EPITOPE[9 a.. A 81.5
/93.1
27
/27
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2.1
3bh9[2] C POF1B_HUMAN decameric peptide from Protein POF1B[10 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3d39[2] C Modified HTLV-1 TAX (Y5(4fluoro)F) peptide[9 aa] A 85.2
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqn[1] C peptide 30-39 from beta-Catenin: YLDSGIHSGA[8 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqr[1] C phospho-peptide 30-39 from beta-Catenin: YLD(Sep)G.. A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqt[1] C peptide 38-46 from cell division cycle 25b (CDC25b.. A 83.3
/93.1
24
/24
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqu[1] C phospho-peptide 38-46 from cell division cycle 25b.. A 86.4
/93.1
22
/22
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqw[1] C peptide 1097-1105 from insulin receptor substrate .. A 76.9
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqx[1] C phospho-peptide 1097-1105 from insulin receptor s.. A 76.9
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3giv[2] C Q9YYH6_9HIV1 HIV-1 peptide[10 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3gjf[6] G Antibody light chain[206 aa] A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3gjf[7] I Antibody heavy chain[220 aa] A 83.3
/93.1
12
/12
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3h7b[3] C Tel1p peptide[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3hg1[6] C CANCER/MART-1[10 aa] A 80.0
/93.1
25
/25
Q8WLS4_HUMAN MHC class I antigen
6dkp[1] C MAR1_HUMAN Melanoma antigen recognized by T-cells 1[10 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3hg1[18] D T-CELL RECEPTOR, ALPHA CHAIN[194 aa] A 81.8
/93.1
11
/11
Q8WLS4_HUMAN MHC class I antigen
7q9b[1] D Human T Cell Receptor Mel8, Alpha Chain[193 aa] F 75.0
/93.1
4
/4
U5YJM1_HUMAN MHC class I antigen
3hg1[10] E T-cell Receptor, Beta Chain[244 aa] A 100.0
/93.1
7
/7
Q8WLS4_HUMAN MHC class I antigen
3hpj[3] C WT1_HUMAN WT126 peptide[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4wuu[1] C ARG-MET-PHE-PRO-ASN-ALA-PRO-TYR-LEU[9 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3i6g[2] C VME1_CVHSA Membrane protein[9 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3kla[2] C CTG1B_HUMAN NYESO-1 peptide analogue[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3mgo[4] C 10-meric peptide from Hemagglutinin[10 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3mgt[4] C Q1WDM0_9INFA 10-meric peptide from Hemagglutinin[10 aa] A 85.7
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3myj[2] C WT1_HUMAN Wilms tumor protein[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3o3a[4] C Peptidomimetic ELA-1[8 aa] A 76.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3o3b[4] C Peptidomimetic ELA-1.1[8 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3pwj[2] C HuD (G2L,I9V) peptide[9 aa] A 82.8
/93.1
29
/29
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3pwl[3] C HuD peptide[9 aa] A 77.8
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3pwn[2] C HuD (G2L) peptide[9 aa] A 82.8
/93.1
29
/29
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3qdg[6] E DMF5 beta chain[242 aa] A 100.0
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3qdm[2] D DMF4 alpha chain[195 aa] A 87.5
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3qdm[2] E DMF4 beta chain[242 aa] A 85.7
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3qfj[1] C TAX(Y5F) peptide[9 aa] A 85.2
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3to2[1] C Q692E0_CVHSA Md3-C9 peptide derived from Membrane glycoprotein[.. A 82.6
/93.1
23
/23
Q53Z42_HUMAN MHC class I antigen
3utq[5] C INS_HUMAN Insulin[10 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3uts[16] D 1E6 TCR Alpha Chain[200 aa] A 60.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3uts[16] E 1E6 TCR Beta Chain[246 aa] A 66.7
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3v5d[2] C HIV peptide KVAELVHFL[9 aa] A 85.2
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3v5h[2] C HIV-based altered-peptide ligand KVAEIVHFL[9 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3v5k[2] C HIV-based altered-peptide ligand KVAELVWFL[9 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4e5x[2] G E3GL_ADE06 Early E3 18.5 kDa glycoprotein[99 aa] A 93.3
/93.1
15
/15
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4gkn[2] C FAT Cognate peptide[10 aa] A 78.3
/93.1
23
/23
A0A5B8RNS7_HUMAN MHC class I antigen
4gks[2] C FLT Cognate peptide[10 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfd[3] C Melanoma peptide[10 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfd[5] D High Affinity TCR Alpha Chain[196 aa] A 81.8
/93.1
11
/11
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfe[1] C Melanoma peptide L7A[10 aa] A 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfo[2] C E1A heteroclitic Melanoma peptide[10 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfq[2] C L8A heteroclitic Melanoma peptide[10 aa] A 77.8
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4k7f[1] F Q9QAC5_HBV Core protein[9 aa] D 80.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4mnq[2] C TERT_HUMAN Telomerase reverse transcriptase[9 aa] A 84.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4mnq[2] D H2RG00_PANTR K7N5M9_HUMAN Uncharacterized protein, T-cell receptor, sp3.4 al.. A 80.0
/93.1
10
/10
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4no0[1] C LSP1_HUMAN Lymphocyte-specific protein 1[12 aa] A 79.2
/93.1
24
/24
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4no5[1] C AMPD2_HUMAN AMP deaminase 2[9 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4uq3[2] E AZOBENZENE-CONTAINING PEPTIDE[6 aa] A 87.5
/93.1
24
/24
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4wj5[2] C MAR1_HUMAN Melanoma antigen recognized by T-cells 1[10 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4wuu[1] D ESK1[212 aa] A 66.7
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4wuu[1] E IMMUNOGLOBULIN HEAVY CHAIN[223 aa] A 77.8
/93.1
18
/18
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c07[3] C Marker peptide[10 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c08[2] C Marker peptide[10 aa] A 77.8
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0f[1] C Marker peptide[10 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c09[3] C Marker peptide[10 aa] A 84.6
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0a[2] C Marker peptide[10 aa] A 77.3
/93.1
22
/22
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n1y[1] C MVWGPDPLYV[10 aa] A 76.0
/93.1
25
/25
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0b[2] C Marker peptide[10 aa] A 80.0
/93.1
30
/30
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0i[1] C Marker peptide[10 aa] A 80.0
/93.1
30
/30
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0c[3] C Marker peptide[10 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0d[1] C Marker peptide[10 aa] A 76.9
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5e00[1] C GLY-VAL-TRP-ILE-ARG-THR-PRO-PRO-ALA[9 aa] A 81.8
/93.1
22
/22
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu3[1] C GP100 peptide YLEPGPVTA[9 aa] A 87.0
/93.1
23
/23
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu4[2] C Peptide antigen YLAPGPVTA[9 aa] A 87.0
/93.1
23
/23
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu5[1] C Peptide antigen YLEPAPVTA[9 aa] A 90.0
/93.1
20
/20
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu6[1] C TYR-LEU-GLU-PRO-GLY-PRO-VAL-THR-VAL[9 aa] A 83.3
/93.1
24
/24
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7phr[1] H PMEL_HUMAN Tumor-associated antigentic peptide gp100[9 aa] F 82.8
/93.1
29
/29
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
5eu6[1] D Human TCR Light Chain[204 aa] A 71.4
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu6[1] E Human TCR Heavy Chain[244 aa] A 90.0
/93.1
10
/10
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5hho[1] E M1-G4E, GILEFVFTL[9 aa] A 78.3
/93.1
23
/23
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5isz[1] D TCRalpha chain[200 aa] A 85.7
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5jhd[2] D TCRalpha chain[201 aa] A 87.5
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5meo[1] C ILE-LEU-GLY-LYS-PHE-LEU-HIS-ARG-LEU[9 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5mep[2] C ILE-LEU-GLY-LYS-PHE-LEU-HIS-TRP-LEU[9 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5meq[1] C ILE-LEU-ALA-LYS-PHE-LEU-HIS-THR-LEU[9 aa] A 79.3
/93.1
29
/29
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5mer[2] C ILE-LEU-ALA-LYS-PHE-LEU-HIS-GLU-LEU[9 aa] A 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[2] C W8FN10_9FLAV NS5[9 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5nme[6] D T-cell receptor Alpha chain[201 aa] A 83.3
/93.1
12
/12
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5nme[6] E Human T-cell receptor beta chain[242 aa] A 87.5
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5tez[1] D TCR F50 alpha chain[202 aa] B 100.0
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5tez[1] E TCR F50 beta chain[240 aa] B 87.5
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5yxn[3] A T cell receptor alpha chain[192 aa] C 77.8
/93.1
9
/9
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5yxn[3] B T cell receptor beta chain[241 aa] C 100.0
/93.1
10
/10
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5yxn[3] E NS3 peptide[10 aa] C 81.5
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6am5[1] C SER-MET-LEU-GLY-ILE-GLY-ILE-VAL-PRO-VAL[10 aa] A 79.2
/93.1
24
/24
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6d78[1] D K7N5M3_HUMAN DMF5 alpha chain,DMF5 alpha chain[185 aa] A 83.3
/93.1
12
/12
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6d7g[1] B Q6PJ56_HUMAN Q6PJ56_HUMAN TRA@ protein[198 aa] A 87.5
/93.1
8
/12
B2MG_HUMAN 1A02_HUMAN MART1 PEPTIDE-BETA-2-MICROGLOBULIN-HLA-A*02 CHIMER..
6d7g[1] C T-CELL RECEPTOR GAMMA VARIABLE 8,T-CELL RECEPTOR G.. A 87.5
/93.1
8
/9
B2MG_HUMAN 1A02_HUMAN MART1 PEPTIDE-BETA-2-MICROGLOBULIN-HLA-A*02 CHIMER..
6ewa[1] D D9IDM8_HUMAN LIR-1[169 aa] A 66.7
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ewc[2] C RETR2_HUMAN Reticulophagy regulator 2[9 aa] A 82.8
/93.1
29
/29
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ewo[1] C SYNEM_HUMAN Synemin[9 aa] A 85.0
/93.1
20
/20
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6g3j[2] C MET-THR-SER-ALA-ILE-GLY-ILE-LEU-PRO-VAL[10 aa] A 78.3
/93.1
23
/23
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6g3k[2] C ILE-THR-SER-GLY-ILE-GLY-VAL-LEU-PRO-VAL[10 aa] A 80.0
/93.1
20
/20
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6nca[20] J RTA_EBVG Replication and transcription activator[9 aa] AB 82.6
/93.1
23
/23
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6opd[1] C Melanoma antigen variant[9 aa] A 85.2
/93.1
27
/27
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ptb[2] C HAUS3_HUMAN HAUS augmin-like complex subunit 3[9 aa] A 80.8
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6pte[4] C HAUS3_HUMAN HAUS augmin-like complex subunit 3[9 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6rp9[2] D T-cell receptor alpha chain[197 aa] A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6vm9[3] D T4H2 T cell receptor alpha chain[201 aa] A 81.8
/93.1
11
/11
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
6rp9[2] E T-cell receptor beta chain[244 aa] A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6rpa[1] D T-cell receptor alpha chain[166 aa] A 71.4
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6rpa[1] E T-cell receptor beta chain[235 aa] A 100.0
/93.1
11
/11
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6rsy[1] D a7b2 ALPHA CHAIN[192 aa] A 80.0
/93.1
10
/10
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6rsy[3] E DMF4 Beta CHAIN[242 aa] A 100.0
/93.1
11
/11
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ss7[2] C LEU-LEU-TRP-ALA-GLY-PRO-MET-ALA-VAL[9 aa] A 79.3
/93.1
29
/29
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ss8[2] C LEU-LEU-TRP-ASN-GLY-PRO-ILE-ALA-VAL[9 aa] A 78.6
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ss9[2] C LEU-LEU-TRP-ASN-GLY-PRO-MET-HIS-VAL[9 aa] A 84.6
/93.1
26
/26
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ssa[4] C LEU-LEU-TRP-ASN-GLY-PRO-MET-GLN-VAL[9 aa] A 82.1
/93.1
28
/28
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6uz1[2] I T cell receptor, alpha chain[108 aa] A 100.0
/93.1
9
/9
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
6uz1[2] J T cell receptor, beta chain[112 aa] A 83.3
/93.1
6
/6
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
6vm7[2] A SILv44 T cell receptor alpha chain[197 aa] C 71.4
/93.1
7
/7
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
6vmc[1] E PMEL_HUMAN Melanocyte protein PMEL[9 aa] C 82.8
/93.1
29
/29
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
6vr1[2] E P53_HUMAN Cellular tumor antigen p53 peptide[9 aa] A 82.1
/93.1
28
/28
Q861F7_HUMAN MHC class I antigen
6vr5[2] F P53_HUMAN Cellular tumor antigen p53 peptide[9 aa] C 88.9
/93.1
27
/27
Q861F7_HUMAN MHC class I antigen
7rm4[4] C P53_HUMAN Cellular tumor antigen p53 peptide[9 aa] A 88.0
/93.1
25
/25
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
6w51[1] S Immunoglobulin heavy chain H2[222 aa] J 83.3
/93.1
6
/6
U5YKE0_HUMAN MHC class I antigen
6z9v[2] C ILE-ILE-GLY-TRP-MET-TRP-ILE-PRO-VAL[9 aa] A 76.9
/93.1
26
/26
A0A5B8RNS7_HUMAN MHC class I antigen
6z9w[2] C LEU-LEU-GLY-TRP-VAL-PHE-ALA-GLN-VAL[9 aa] A 87.5
/93.1
24
/24
U5YJM1_HUMAN MHC class I antigen
6z9x[2] C LEU-LEU-SER-TUR-PHE-GLY-THR-PRO-THR[9 aa] A 78.3
/93.1
23
/23
A0A5B8RNS7_HUMAN MHC class I antigen
7eu2[2] C SARS-CoV-2 T-cell Epitope S1[9 aa] A 84.0
/93.1
25
/25
A0A5H2UU57_HUMAN MHC class I antigen
7kgo[1] C NCAP_SARS2 Nucleoprotein[9 aa] A 83.3
/93.1
24
/24
Q861F7_HUMAN MHC class I antigen
7m8s[1] C SPIKE_SARS2 Spike protein S1 peptide[10 aa] A 80.0
/93.1
30
/30
Q861F7_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7mj6[1] C IBPL1_HUMAN Insulin-like growth factor-binding protein-like 1 .. A 76.0
/93.1
25
/25
Q861F7_HUMAN MHC class I antigen
7mj7[1] C IBPL1_HUMAN Insulin-like growth factor-binding protein-like 1 .. A 80.8
/93.1
26
/26
Q861F7_HUMAN MHC class I antigen
7mj8[1] C IBPL1_HUMAN Insulin-like growth factor-binding protein-like 1 .. A 83.3
/93.1
24
/24
Q861F7_HUMAN MHC class I antigen
7mj9[1] C IBPL1_HUMAN Insulin-like growth factor-binding protein-like 1 .. A 87.0
/93.1
23
/23
Q861F7_HUMAN MHC class I antigen
7n1a[1] C SPIKE_SARS2 Spike protein S1[9 aa] A 77.8
/93.1
27
/27
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7n6d[7] C SPIKE_SARS2 Spike protein S1[9 aa] A 79.3
/93.1
29
/29
Q861F7_HUMAN MHC class I antigen
7p3e[2] C TYR-LEU-GLN-LEU-ARG-THR-PHE-LEU-LEU[9 aa] A 79.3
/93.1
29
/29
A0A5B8RNS7_HUMAN MHC class I antigen
7pbc[3] D T-cell receptor (TRBV/TRBC)[240 aa] A 83.3
/93.1
6
/6
Q861F7_HUMAN MHC class I antigen
7pbc[4] E MAGAA_HUMAN Melanoma-associated antigen 10[9 aa] A 80.8
/93.1
26
/26
Q861F7_HUMAN MHC class I antigen
7pbe[2] D Human T-cell Receptor YLQ36, alpha chain[199 aa] A 85.7
/93.1
7
/7
A0A5B8RNS7_HUMAN MHC class I antigen
7phr[1] A T-cell receptor alpha chain[243 aa] F 83.3
/93.1
12
/12
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7q98[6] C ASN-LEU-SER-ALA-LEU-GLY-ILE-PHE-SER-THR[10 aa] A 82.1
/93.1
28
/28
A0A5B8RNS7_HUMAN MHC class I antigen
7q9a[1] C LEU-LEU-LEU-GLY-ILE-GLY-ILE-LEU-VAL-LEU[10 aa] A 82.1
/93.1
28
/28
A0A5B8RNS7_HUMAN MHC class I antigen
7qpj[1] E T-cell receptor beta chain[238 aa] A 100.0
/93.1
6
/6
Q861F7_HUMAN MHC class I antigen
7re7[2] C Fab heavy chain[212 aa] E 80.0
/93.1
10
/10
Q861F7_HUMAN MHC class I antigen
7re7[2] D Fab light chain[211 aa] E 100.0
/93.1
6
/6
Q861F7_HUMAN MHC class I antigen
7re7[2] I PHE-MET-ASN-LYS-PHE-ILE-TYR-GLU-ILE[9 aa] E 82.8
/93.1
29
/29
Q861F7_HUMAN MHC class I antigen
7re8[2] C PHE-MET-ASN-LYS-PHE-ILE-TYR-GLU-ILE[9 aa] A 82.8
/93.1
29
/29
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7rm4[4] E 6-11 T cell receptor alpha chain[200 aa] A 100.0
/93.1
6
/6
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7t5m[1] E I27RA_HUMAN Interleukin-27 receptor subunit alpha[17 aa] A 80.6
/93.1
31
/31
Q861F7_HUMAN MHC class I antigen
7t5m[1] F I27RA_HUMAN Interleukin-27 receptor subunit alpha[16 aa] C 77.8
/93.1
27
/27
Q861F7_HUMAN MHC class I antigen
7tr4[1] C Light chain[211 aa] A 90.0
/93.1
10
/10
HLA-A*02:01
7u1r[1] C SPIKE_SARS2 Spike protein S2' peptide [9 aa] A 86.2
/93.1
29
/29
Q53Z42_HUMAN HLA class I antigen
7u21[2] C PGM5 peptide (465-473) (H5Y)[9 aa] A 78.9
/93.1
19
/19
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7um2[1] C SARS-CoV-2 Spike-derived peptide S417-425 K417T mu.. A 75.9
/93.1
29
/29
Q53Z42_HUMAN HLA class I antigen
7ur1[1] C SARS-CoV-2 Spike-derived peptide S1215-1224 (YIWLG.. A 81.8
/93.1
22
/22
Q53Z42_HUMAN HLA class I antigen
7zuc[2] C LEU-LEU-LEU-GLY-ILE-GLY-ILE-LEU-VAL[9 aa] A 79.3
/93.1
29
/29
A0A5B8RNS7_HUMAN MHC class I antigen
8dnt[2] B T-cell receptor beta chain[242 aa] D 100.0
/93.1
5
/5
U5YKE0_HUMAN MHC class I antigen alpha chain
8dnt[2] C NCAP_SARS2 Nucleoprotein[9 aa] D 82.8
/93.1
29
/29
U5YKE0_HUMAN MHC class I antigen alpha chain
8eb2[2] L PA2.1 Fab Heavy Chain[215 aa] A 83.3
/93.1
12
/12
Q53Z42_HUMAN HLA-A*02:01 alpha chain
8eb2[2] M PA2.1 Fab Light Chain[217 aa] A 66.7
/93.1
3
/3
Q53Z42_HUMAN HLA-A*02:01 alpha chain
8es8[1] G PN45545 TCR alpha chain[257 aa] I 81.8
/93.1
11
/11
Q861F7_HUMAN MHC class I antigen
8es8[1] H PN45545 TCR beta chain[287 aa] I 100.0
/93.1
5
/5
Q861F7_HUMAN MHC class I antigen
8es9[1] A PN45428 TCR alpha chain[251 aa] I 100.0
/93.1
7
/7
Q861F7_HUMAN MHC class I antigen
8es9[1] B PN45428 TCR beta chain[287 aa] I 66.7
/93.1
3
/3
Q861F7_HUMAN MHC class I antigen
8gom[1] C SPIKE_SARS2 Spike protein S2[9 aa] A 85.2
/93.1
27
/27
Q861F7_HUMAN MHC class I antigen
8gom[2] D SARS-CoV-2 specific private TCR RLQ7 alpha[191 aa].. A 80.0
/93.1
10
/10
Q861F7_HUMAN MHC class I antigen
8gom[2] E SARS-CoV-2 specific private TCR RLQ7 beta[244 aa] A 100.0
/93.1
11
/11
Q861F7_HUMAN MHC class I antigen
8gon[1] C SPIKE_SARS2 Spike protein S2[9 aa] A 82.1
/93.1
28
/28
Q861F7_HUMAN MHC class I antigen
8tbv[4] C Sorting nexin 24 (127-135)(P132L) peptide[9 aa] A 80.8
/93.1
26
/26
Q53Z42_HUMAN HLA-A*02:01 alpha chain
8tbw[2] C Sorting nexin 24 (127-135) peptide[9 aa] A 83.3
/93.1
24
/24
Q53Z42_HUMAN HLA-A*02:01 alpha chain
7sa2[1] C SPIKE_SARS2 Spike protein S2' peptide VVFLHVTYV [9 aa] A 80.8
/92.8
26
/26
Q861F7_HUMAN MHC class I antigen
7sis[1] C SPIKE_SARS2 Spike protein S2' peptide VLNDILSRL [9 aa] A 85.2
/92.8
27
/27
Q861F7_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7kgp[1] C NCAP_SARS2 Nucleoprotein[9 aa] A 80.0
/92.4
25
/25
Q861F7_HUMAN MHC class I antigen
7kgs[1] C NCAP_SARS2 Nucleoprotein[9 aa] A 77.8
/92.4
27
/27
Q861F7_HUMAN MHC class I antigen
7kgt[1] C NCAP_SARS2 Nucleoprotein[3 aa] A 86.7
/92.4
15
/15
Q861F7_HUMAN MHC class I antigen
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1hsb[1] E ARG
ARGININE[12 atoms]
A 100.0
/94.1
11
/11
1A68_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68.1)
2gj6[1] S 3IB
3-INDOLEBUTYRIC ACID[14 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfd[1] F TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms]
A 66.7
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6tmo[1] O TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms]
A 100.0
/93.1
5
/5
A0A5B8RNS7_HUMAN MHC class I antigen
6tmo[1] Y TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms]
A 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
6z9v[1] Z PE8
3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL[25 a..
D 70.0
/93.1
10
/10
A0A5B8RNS7_HUMAN MHC class I antigen
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5wjl[2] J CL
CHLORIDE ION[1 atoms]
A 50.0
/97.4
2
/2
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
7kgo[1] F CL
CHLORIDE ION[1 atoms]
A 100.0
/93.1
3
/3
Q861F7_HUMAN MHC class I antigen
7kgo[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/93.1
2
/2
Q861F7_HUMAN MHC class I antigen
7m8t[1] G CL
CHLORIDE ION[1 atoms]
A 100.0
/97.5
3
/3
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
3fqn[3] H MG
MAGNESIUM ION[1 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqn[4] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6pbh[1] E MG
MAGNESIUM ION[1 atoms]
A 100.0
/94.2
1
/1
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
7s8r[1] G MG
MAGNESIUM ION[1 atoms]
A 100.0
/97.5
1
/1
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7s8r[1] I MG
MAGNESIUM ION[1 atoms]
D 100.0
/97.5
1
/1
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7s8r[1] J MG
MAGNESIUM ION[1 atoms]
D 100.0
/97.5
1
/1
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7t5m[1] H MG
MAGNESIUM ION[1 atoms]
A 33.3
/93.1
3
/3
Q861F7_HUMAN MHC class I antigen
7t5m[1] I MG
MAGNESIUM ION[1 atoms]
C 100.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
7tlt[1] I MG
MAGNESIUM ION[1 atoms]
A 100.0
/94.2
1
/1
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7tlt[1] L MG
MAGNESIUM ION[1 atoms]
A 50.0
/94.2
2
/2
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
6ei2[1] F NI
NICKEL (II) ION[1 atoms]
A 0.0
/94.2
1
/1
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
6ei2[1] I NI
NICKEL (II) ION[1 atoms]
A 100.0
/94.2
2
/2
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
2f53[1] F NA
SODIUM ION[1 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen
3bh9[2] D NA
SODIUM ION[1 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4no5[2] E NA
SODIUM ION[1 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ss7[2] G NA
SODIUM ION[1 atoms]
A 83.3
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7kgp[1] G NA
SODIUM ION[1 atoms]
A 66.7
/92.4
3
/3
Q861F7_HUMAN MHC class I antigen
7kgp[1] H NA
SODIUM ION[1 atoms]
A 100.0
/92.4
1
/1
Q861F7_HUMAN MHC class I antigen
7kgp[1] I NA
SODIUM ION[1 atoms]
A 100.0
/92.4
2
/2
Q861F7_HUMAN MHC class I antigen
7m8t[1] F NA
SODIUM ION[1 atoms]
A 100.0
/97.5
2
/2
U5YJK1_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7tlt[1] K NA
SODIUM ION[1 atoms]
A 100.0
/94.2
3
/3
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7tlt[1] M NA
SODIUM ION[1 atoms]
C 100.0
/94.2
1
/1
B0UXQ0_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7u1r[1] F NA
SODIUM ION[1 atoms]
A 100.0
/93.1
3
/3
Q53Z42_HUMAN HLA class I antigen
7um2[1] F NA
SODIUM ION[1 atoms]
A 100.0
/93.1
1
/1
Q53Z42_HUMAN HLA class I antigen
3fqn[6] D CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqn[6] E CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqn[7] F CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqn[7] G CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqt[4] D CD
CADMIUM ION[1 atoms]
A 0.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3fqt[6] H CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ei2[1] G CD
CADMIUM ION[1 atoms]
A 100.0
/94.2
2
/2
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
6ei2[1] H CD
CADMIUM ION[1 atoms]
A 100.0
/94.2
2
/2
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
7u1r[2] D CD
CADMIUM ION[1 atoms]
A 100.0
/93.1
2
/2
Q53Z42_HUMAN HLA class I antigen
5c0e[1] D BR
BROMIDE ION[1 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5mer[2] I CA
CALCIUM ION[1 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6pbh[1] D IOD
IODIDE ION[1 atoms]
A 100.0
/94.2
3
/3
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
7p3e[1] G IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[2] H IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[2] I IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] J IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
1
/1
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[2] K IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
1
/1
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] L IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] M IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] N IOD
IODIDE ION[1 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] FA IOD
IODIDE ION[1 atoms]
D 100.0
/93.1
1
/1
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] T IOD
IODIDE ION[1 atoms]
D 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] U IOD
IODIDE ION[1 atoms]
D 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] W IOD
IODIDE ION[1 atoms]
D 100.0
/93.1
1
/1
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] Z IOD
IODIDE ION[1 atoms]
D 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7kgo[1] D 3NI
NICKEL (III) ION[1 atoms]
A 100.0
/93.1
3
/3
Q861F7_HUMAN MHC class I antigen
7kgo[1] E 3NI
NICKEL (III) ION[1 atoms]
A 100.0
/93.1
2
/2
Q861F7_HUMAN MHC class I antigen
7sis[1] F ZN
ZINC ION[1 atoms]
A 100.0
/92.8
2
/2
Q861F7_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7u1r[2] E ZN
ZINC ION[1 atoms]
A 100.0
/93.1
2
/2
Q53Z42_HUMAN HLA class I antigen
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6eny[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. D 100.0
/100.0
4
/4
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7qpd[1] G alpha-D-glucopyranose-(1-3)-alpha-D-mannopyranose-.. D 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3bh9[2] A 1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha .. A 90.9
/93.1
11
/11
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
365 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1x7q[49] D SO4
SULFATE ION[5 atoms]
A 100.0
/97.5
1
/1
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
1x7q[53] E SO4
SULFATE ION[5 atoms]
A 66.7
/97.5
3
/3
1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha..
2gj6[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2gj6[17] J SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2p5e[3] L SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2p5w[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3hg1[8] H SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
3
/3
Q8WLS4_HUMAN MHC class I antigen
4gkn[10] G SO4
SULFATE ION[5 atoms]
A 0.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
4gkn[4] H SO4
SULFATE ION[5 atoms]
A 66.7
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
4jfd[1] K SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfp[5] J SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5brz[1] G SO4
SULFATE ION[5 atoms]
A 71.4
/94.5
7
/7
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
5bs0[2] J SO4
SULFATE ION[5 atoms]
A 100.0
/94.5
2
/2
1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha ..
5c09[10] O SO4
SULFATE ION[5 atoms]
F 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0b[17] U SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0f[3] O SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0j[1] J SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5e00[5] D SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu5[4] AA SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu6[2] N SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5men[2] J SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5meo[2] Q SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[1] R SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5nmf[1] M SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6o9c[2] F SO4
SULFATE ION[5 atoms]
A 100.0
/99.6
3
/3
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9c[1] G SO4
SULFATE ION[5 atoms]
A 100.0
/99.6
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9c[2] H SO4
SULFATE ION[5 atoms]
A 100.0
/99.6
3
/3
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6pbh[1] F SO4
SULFATE ION[5 atoms]
A 100.0
/94.2
4
/4
1A68_HUMAN HLA class I histocompatibility antigen, A-68 alpha..
6z9v[2] L SO4
SULFATE ION[5 atoms]
A 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[1] CA SO4
SULFATE ION[5 atoms]
D 100.0
/93.1
6
/6
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[1] OA SO4
SULFATE ION[5 atoms]
G 100.0
/93.1
5
/5
A0A5B8RNS7_HUMAN MHC class I antigen
8dvg[1] N SO4
SULFATE ION[5 atoms]
A 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
5euo[1] K IMD
IMIDAZOLE[5 atoms]
C 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6o9b[1] F IMD
IMIDAZOLE[5 atoms]
A 100.0
/99.6
7
/7
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9b[1] G IMD
IMIDAZOLE[5 atoms]
A 100.0
/99.6
3
/3
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
1hsb[1] D ALA
ALANINE[5 atoms]
A 100.0
/94.1
2
/2
1A68_HUMAN CLASS I HISTOCOMPATIBILITY ANTIGEN (HLA-AW68.1)
1i4f[1] D 1PG
2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHO..
A 100.0
/93.1
6
/6
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1i4f[1] E 1PG
2-(2-{2-[2-(2-METHOXY-ETHOXY)-ETHOXY]-ETHOXY}-ETHO..
A 100.0
/93.1
5
/5
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
1tvb[417] G GOL
GLYCEROL[6 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvb[1] Q GOL
GLYCEROL[6 atoms]
D 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvb[2] R GOL
GLYCEROL[6 atoms]
D 80.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvh[1] I GOL
GLYCEROL[6 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvh[1] L GOL
GLYCEROL[6 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
1tvh[1] DA GOL
GLYCEROL[6 atoms]
D 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2gt9[25] G GOL
GLYCEROL[6 atoms]
A 66.7
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen
5c07[1] CA GOL
GLYCEROL[6 atoms]
F 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n1y[2] Q GOL
GLYCEROL[6 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7qpj[1] I GOL
GLYCEROL[6 atoms]
A 75.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
2git[1] L FMT
FORMIC ACID[3 atoms]
A 50.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2git[1] P FMT
FORMIC ACID[3 atoms]
D 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2git[1] Q FMT
FORMIC ACID[3 atoms]
D 50.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2git[1] R FMT
FORMIC ACID[3 atoms]
D 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2git[1] S FMT
FORMIC ACID[3 atoms]
D 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2gtw[1] I FMT
FORMIC ACID[3 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA-A*0201 heavy chain
2gtw[2] J FMT
FORMIC ACID[3 atoms]
A 100.0
/93.1
5
/5
1A02_HUMAN HLA-A*0201 heavy chain
2gtw[1] M FMT
FORMIC ACID[3 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA-A*0201 heavy chain
7l1c[1] F FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
4
/4
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7l1c[1] G FMT
FORMIC ACID[3 atoms]
A 100.0
/100.0
3
/3
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7re7[1] W FMT
FORMIC ACID[3 atoms]
G 100.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
2p5e[1] N IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4uq3[1] G IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4uq3[1] H IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4uq3[2] I IPA
ISOPROPYL ALCOHOL[4 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4uq3[1] K IPA
ISOPROPYL ALCOHOL[4 atoms]
C 100.0
/93.1
4
/4
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4uq3[1] L IPA
ISOPROPYL ALCOHOL[4 atoms]
C 100.0
/93.1
3
/3
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2pye[1] H PGE
TRIETHYLENE GLYCOL[10 atoms]
A 75.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2pye[1] I PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7re7[1] AA PGE
TRIETHYLENE GLYCOL[10 atoms]
G 100.0
/93.1
2
/2
Q861F7_HUMAN MHC class I antigen
7re8[2] G PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7re8[1] N PGE
TRIETHYLENE GLYCOL[10 atoms]
A 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7re8[2] O PGE
TRIETHYLENE GLYCOL[10 atoms]
A 57.1
/93.1
7
/7
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
2pye[1] J 7PE
2-(2-(2-(2-(2-(2-ETHOXYETHOXY)ETHOXY)ETHOXY)ETHOXY..
A 100.0
/93.1
11
/11
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
2x4n[26] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
D 100.0
/93.1
3
/3
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2x4n[8] P MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
D 100.0
/93.1
2
/2
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
2x4u[1] H MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/93.1
7
/7
1A02_HUMAN HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-2 ALPHA ..
4jfq[2] N MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0f[1] N MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 85.7
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5mer[2] J MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 50.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6o9b[2] E MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms]
A 100.0
/99.6
4
/4
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
3bh9[8] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
3bh9[269] F EDO
1,2-ETHANEDIOL[4 atoms]
A 25.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4gks[4] V EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4mnq[1] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0b[1] SB EDO
1,2-ETHANEDIOL[4 atoms]
F 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[6] E EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[5] G EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0f[2] H EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0g[11] E EDO
1,2-ETHANEDIOL[4 atoms]
A 66.7
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu5[1] H EDO
1,2-ETHANEDIOL[4 atoms]
A 75.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5eu5[1] L EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5meo[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6o9b[1] J EDO
1,2-ETHANEDIOL[4 atoms]
A 100.0
/99.6
5
/5
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
7q98[1] FA EDO
1,2-ETHANEDIOL[4 atoms]
D 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
4jff[2] F EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 75.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jff[4] K EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
4jfp[1] U EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
D 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[2] L EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
A 100.0
/93.1
6
/6
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7re7[1] T EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI..
E 100.0
/93.1
2
/2
Q861F7_HUMAN MHC class I antigen
5c0c[1] N PG4
TETRAETHYLENE GLYCOL[10 atoms]
A 100.0
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[3] DA PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 80.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[4] EA PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[2] FA PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] IA PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] U PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 80.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] V PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
9
/9
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] W PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] X PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0e[1] Y PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
8
/8
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7n1a[1] G PG4
TETRAETHYLENE GLYCOL[13 atoms]
A 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7re7[1] Q PG4
TETRAETHYLENE GLYCOL[13 atoms]
E 100.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
7re7[1] R PG4
TETRAETHYLENE GLYCOL[13 atoms]
E 100.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
7re7[1] Z PG4
TETRAETHYLENE GLYCOL[13 atoms]
G 100.0
/93.1
5
/5
Q861F7_HUMAN MHC class I antigen
5c0f[1] CA ACY
ACETIC ACID[4 atoms]
A 0.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5c0f[1] S ACY
ACETIC ACID[4 atoms]
A 100.0
/93.1
4
/4
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[3] M PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
7
/7
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[4] N PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
5n6b[2] BA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6id4[7] L PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/97.4
5
/5
F6IQY1_HUMAN MHC class I antigen
6o9b[1] H PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/99.6
5
/5
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9b[3] I PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/99.6
4
/4
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6o9b[4] Q PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/99.6
4
/4
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
6ss8[1] Q PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
1
/1
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ss8[3] W PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 100.0
/93.1
5
/5
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6ssa[1] BA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
J 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7p3e[1] O PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
7p3e[1] AA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 66.7
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[4] P PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[2] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[1] V PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
D 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen
7q98[3] QA PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
G 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen
7re8[1] J PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
5
/5
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7re8[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7re8[1] T PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
E 80.0
/93.1
5
/5
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
8dvg[1] K PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/100.0
1
/1
1A03_HUMAN HLA class I histocompatibility antigen, A-3 alpha ..
8tbv[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
5
/5
Q53Z42_HUMAN HLA-A*02:01 alpha chain
8u9g[1] G PEG
DI(HYDROXYETHYL)ETHER[7 atoms]
A 100.0
/93.1
3
/3
Q53Z42_HUMAN HLA-A*02:01 alpha chain
6ss8[1] X P4G
1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE[11 atoms]
D 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6z9v[1] Q P4G
1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE[11 atoms]
A 100.0
/93.1
4
/4
A0A5B8RNS7_HUMAN MHC class I antigen
6z9v[1] Y P4G
1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE[11 atoms]
D 50.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
6vm8[1] F FLC
CITRATE ANION[13 atoms]
A 100.0
/93.1
1
/1
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7pdw[1] K PO4
PHOSPHATE ION[5 atoms]
J 100.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
7re7[1] S P6G
HEXAETHYLENE GLYCOL[19 atoms]
E 100.0
/93.1
5
/5
Q861F7_HUMAN MHC class I antigen
7re7[1] V 1PE
PENTAETHYLENE GLYCOL[16 atoms]
G 100.0
/93.1
6
/6
Q861F7_HUMAN MHC class I antigen
7re8[2] I 1PE
PENTAETHYLENE GLYCOL[16 atoms]
A 100.0
/93.1
3
/3
A0A5B8RNS7_HUMAN MHC class I antigen, A-2 alpha chain
7t5m[1] G TRS
2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL[8 atoms]
A 75.0
/93.1
4
/4
Q861F7_HUMAN MHC class I antigen
8tbw[2] G NO3
NITRATE ION[4 atoms]
A 100.0
/93.1
4
/4
Q53Z42_HUMAN HLA-A*02:01 alpha chain
6opd[1] D ACT
ACETATE ION[4 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6opd[1] E ACT
ACETATE ION[4 atoms]
A 100.0
/93.1
2
/2
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
6opd[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/93.1
3
/3
1A02_HUMAN HLA class I histocompatibility antigen, A-2 alpha ..
7kgp[1] D ACT
ACETATE ION[4 atoms]
A 66.7
/92.4
3
/3
Q861F7_HUMAN MHC class I antigen
7kgs[2] F ACT
ACETATE ION[4 atoms]
A 50.0
/92.4
2
/2
Q861F7_HUMAN MHC class I antigen
7kgt[1] G ACT
ACETATE ION[4 atoms]
A 100.0
/92.4
5
/5
Q861F7_HUMAN MHC class I antigen
7l1d[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/100.0
1
/1
HLAA_HUMAN HLA class I histocompatibility antigen, A alpha ch..
7p3d[1] F ACT
ACETATE ION[4 atoms]
A 100.0
/93.1
2
/2
A0A5B8RNS7_HUMAN MHC class I antigen
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.