Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3206261 296 41 P04233(HG2A_HUMAN) RecName: Full=HLA class II histocompatibility antigen gamma chain ;AltName: Full=HLA-DR antigens-associated invariant chain;AltName: Full=Ia antigen-associated invariant chain; Short=Ii;AltName: CD_antigen=CD74;Contains: RecName: Full=Class-II-associated invariant chain peptide ; Short=CLIP ;
QUERYSEQ
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNAD
PLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKCDENGNYLPLQCYGSIGYCWCVFPNGTEVPNTRSRGHHNCSESLELEDPSSGLGVTKQDLGPVPM
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P04233(HG2A_HUMAN)]

296
region name description
1-296 CHAIN /note="HLA class II histocompatibility antigen gamma chain" /id="PRO_0000067954"
97-120 PEPTIDE /note="Class-II-associated invariant chain peptide" /id="PRO_0000448886"
1-46 TOPO_DOM /note="Cytoplasmic"
47-72 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
73-296 TOPO_DOM /note="Extracellular"
210-271 DOMAIN /note="Thyroglobulin type-1"
1-40 REGION /note="Disordered"
225-226 REGION /note="Required for interaction with CTSL" ECO:0000305|PubMed:32855215"
263-296 REGION /note="Disordered"
1-296 DISORDER predicted by DISOPRED

MONOMER
296
pdb_id a1 identity[%]2 description
1iie C 100.0
1l3h A 100.0
8vsp I 100.0
7n4y B 38.8
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.