Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3207930 164 29 P01185(NEU2_HUMAN) RecName: Full=Vasopressin-neurophysin 2-copeptin;AltName: Full=AVP-NPII;Contains: RecName: Full=Arg-vasopressin; AltName: Full=Arginine-vasopressin;Contains: RecName: Full=Neurophysin 2; AltName: Full=Neurophysin-II;Contains: RecName: Full=Copeptin;Flags: Precursor;
QUERYSEQ
MPDTMLPACFLGLLAFSSACYFQNCPRGGKRAMSDLELRQCLPCGPGGKGRCFGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAAFGVCCNDESCVTEPECREGFHRRARASDRSNATQLDGPAGALLLRLVQLA
GAPEPFEPAQPDAY
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P01185(NEU2_HUMAN)]

164
region name description
1-19 SIGNAL
20-28 PEPTIDE /note="Arg-vasopressin" /id="PRO_0000020515"
32-124 CHAIN /note="Neurophysin 2" /id="PRO_0000020516"
126-164 PEPTIDE /note="Copeptin" /id="PRO_0000020517"
1-164 DISORDER predicted by DISOPRED

MONOMER
164
pdb_id a1 identity[%]2 description
2bn2 A 95.3
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.