Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]


[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1694248 400 13 P00973(OAS1_HUMAN) RecName: Full=2'-5'-oligoadenylate synthase 1; Short=(2-5')oligo(A) synthase 1; Short=2-5A synthase 1; EC=2.7.7.84 ;AltName: Full=E18/E16;AltName: Full=p46/p42 OAS;
QUERYSEQ 
MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVL
PAFDALGQLTGGYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILD
PADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLAESNSADDETDDPRRYQKYGYIGTHEYPHFSHRPSTLQAASTPQAEEDWTCTIL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P00973(OAS1_HUMAN)]

400
region name description
1-400 CHAIN /note="2'-5'-oligoadenylate synthase 1" /id="PRO_0000160259"
13-60 REGION /note="Interaction with dsRNA" ECO:0007744|PDB:4IG8"
200-210 REGION /note="Interaction with dsRNA" ECO:0007744|PDB:4IG8"
63-63 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0007744|PDB:4IG8"
75-75 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_note="catalytic" ECO:0007744|PDB:4IG8"
77-77 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_note="catalytic" ECO:0007744|PDB:4IG8"
148-148 BINDING /ligand="Mg(2+)" /ligand_id="ChEBI:CHEBI:18420" /ligand_note="catalytic" ECO:0007744|PDB:4IG8"
210-210 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616"
213-213 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0007744|PDB:4IG8"
229-229 BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" ECO:0007744|PDB:4IG8"
397-397 LIPID /note="S-geranylgeranyl cysteine"
1-395 DISORDER predicted by DISOPRED

MONOMER
400
pdb_id a1 identity[%]2 description
4ig8 A 100.0 OAS1_HUMAN 2'-5'-oligoadenylate synthase 1 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
400 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6p8v[1] E D7Y2H4_ECOLX ATPase, AAA family[298 aa] G 23.1
/26.8		 13
/13		 D7Y2H2_ECOLX E. coli MS115-1 CdnC
6p8v[1] F D7Y2H4_ECOLX ATPase, AAA family[270 aa] G 40.0
/26.8		 5
/8		 D7Y2H2_ECOLX E. coli MS115-1 CdnC
6p8v[2] H A0A1X1LKT4_ECOLX E. coli MS115-1 HORMA[170 aa] G 50.0
/26.8		 2
/14		 D7Y2H2_ECOLX E. coli MS115-1 CdnC
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
400 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4ig8[1] B RNA (5'-R(*GP*GP*CP*UP*UP*UP*UP*GP*AP*CP*CP*UP*UP*.. A 100.0
/100.0		 15
/15		 OAS1_HUMAN 2'-5'-oligoadenylate synthase 1
4ig8[1] C RNA (5'-R(*GP*CP*AP*UP*AP*AP*AP*GP*GP*UP*CP*AP*AP*.. A 100.0
/100.0		 16
/16		 OAS1_HUMAN 2'-5'-oligoadenylate synthase 1
4rwp[1] C RNA (5'-R(*UP*UP*CP*AP*UP*AP*AP*AP*GP*GP*UP*CP*AP*.. A 81.8
/75.4		 22
/22		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
4rwn[3] B RNA (5'-R(*GP*GP*CP*UP*UP*UP*UP*GP*AP*CP*CP*UP*UP*.. A 76.5
/75.4		 17
/17		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
4s3n[1] B RNA (5'-R(*GP*GP*CP*UP*UP*UP*UP*GP*AP*CP*CP*UP*UP*.. A 40.0
/47.0		 10
/10		 OAS3_HUMAN 2'-5'-oligoadenylate synthase 3
4rwn[2] C RNA (5'-R(*UP*UP*CP*AP*UP*AP*AP*AP*GP*GP*UP*CP*AP*.. A 84.2
/75.4		 19
/19		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
4s3n[1] C RNA (5'-R(*UP*UP*CP*AP*UP*AP*AP*AP*GP*GP*UP*CP*AP*.. A 46.7
/47.0		 15
/15		 OAS3_HUMAN 2'-5'-oligoadenylate synthase 3
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
400 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4ig8[1] F DTP
2'-DEOXYADENOSINE 5'-TRIPHOSPHATE [30 atoms] 		A 100.0
/100.0		 9
/9		 OAS1_HUMAN 2'-5'-oligoadenylate synthase 1
4rwn[2] D APC
DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER[31 a.. 		A 100.0
/75.4		 13
/13		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
4rwn[1] E APC
DIPHOSPHOMETHYLPHOSPHONIC ACID ADENOSYL ESTER[31 a.. 		A 100.0
/75.4		 9
/9		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
6p80[2] B ATP
ADENOSINE-5'-TRIPHOSPHATE[31 atoms] 		A 43.8
/26.8		 16
/16		 D7Y2H2_ECOLX E. coli MS115-1 NucC
6u7b[1] K AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		C 28.6
/26.8		 14
/14		 D7Y2H2_ECOLX E. coli MS115-1 CdnC
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
400 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4ig8[2] D MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 OAS1_HUMAN 2'-5'-oligoadenylate synthase 1
4rwn[7] F MG
MAGNESIUM ION[1 atoms] 		A 100.0
/75.4		 3
/3		 OAS1_PIG 2'-5'-oligoadenylate synthase 1
6p80[2] D CL
CHLORIDE ION[1 atoms] 		A 66.7
/26.8		 6
/6		 D7Y2H2_ECOLX E. coli MS115-1 NucC
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
400 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
1px5[2] C SO4
SULFATE ION[5 atoms] 		A 100.0
/75.5		 1
/1		 OAS1_PIG 2'-5'-oligoadenylate synthetase 1
1px5[1] D SO4
SULFATE ION[5 atoms] 		A 100.0
/75.5		 3
/3		 OAS1_PIG 2'-5'-oligoadenylate synthetase 1
1px5[1] F SO4
SULFATE ION[5 atoms] 		B 0.0
/75.2		 1
/1		 OAS1_PIG 2'-5'-oligoadenylate synthetase 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.