Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3935585 258 14 O95721(SNP29_HUMAN) RecName: Full=Synaptosomal-associated protein 29 ; Short=SNAP-29 ;AltName: Full=Soluble 29 kDa NSF attachment protein ;AltName: Full=Vesicle-membrane fusion protein SNAP-29;
QUERYSEQ 
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI
STSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O95721(SNP29_HUMAN)]

258
region name description
1-258 CHAIN /note="Synaptosomal-associated protein 29" /id="PRO_0000213601"
196-258 DOMAIN /note="t-SNARE coiled-coil homology"
1-41 REGION /note="Disordered"
150-191 REGION /note="Disordered"
76-107 COILED
10-36 COMPBIAS /note="Basic and acidic residues"
161-175 COMPBIAS /note="Basic and acidic residues"
1-258 DISORDER predicted by DISOPRED

MONOMER
258
pdb_id a1 identity[%]2 description
4wy4 C 100.0 SNP29_HUMAN Synaptosomal-associated protein 29
7bv6 H 100.0 SNP29_HUMAN Synaptosomal-associated protein 29 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
258 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4wy4[1] A VAMP8_HUMAN Vesicle-associated membrane protein 8[64 aa] C 100.0
/100.0		 3
/3		 SNP29_HUMAN Synaptosomal-associated protein 29
4wy4[7] A VAMP8_HUMAN Vesicle-associated membrane protein 8[64 aa] D 100.0
/100.0		 24
/24		 SNP29_HUMAN Synaptosomal-associated protein 29
7bv6[6] A VAMP8_HUMAN Vesicle-associated membrane protein 8[66 aa] C 100.0
/100.0		 4
/4		 SNP29_HUMAN Synaptosomal-associated protein 29
4wy4[7] B STX17_HUMAN Syntaxin-17[58 aa] C 100.0
/100.0		 25
/25		 SNP29_HUMAN Synaptosomal-associated protein 29
4wy4[1] B STX17_HUMAN Syntaxin-17[58 aa] D 100.0
/100.0		 5
/5		 SNP29_HUMAN Synaptosomal-associated protein 29
7bv6[6] B STX17_HUMAN Syntaxin-17[61 aa] D 100.0
/100.0		 5
/5		 SNP29_HUMAN Synaptosomal-associated protein 29
4wy4[7] D SNP29_HUMAN Synaptosomal-associated protein 29[65 aa] C 100.0
/100.0		 28
/28		 SNP29_HUMAN Synaptosomal-associated protein 29
4wy4[7] C SNP29_HUMAN Synaptosomal-associated protein 29[78 aa] D 100.0
/100.0		 27
/27		 SNP29_HUMAN Synaptosomal-associated protein 29
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.