Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3209857 904 500 O15455(TLR3_HUMAN) RecName: Full=Toll-like receptor 3 ;AltName: CD_antigen=CD283;Flags: Precursor;
QUERYSEQ
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLI
TLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQ
EWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQ
TEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O15455(TLR3_HUMAN)]

904
region name description
1-23 SIGNAL
24-904 CHAIN /note="Toll-like receptor 3" /id="PRO_0000034715"
24-704 TOPO_DOM /note="Lumenal"
705-725 TRANSMEM /note="Helical"
726-904 TOPO_DOM /note="Cytoplasmic"
24-51 DOMAIN /note="LRRNT"
52-73 REPEAT /note="LRR 1"
76-97 REPEAT /note="LRR 2"
100-121 REPEAT /note="LRR 3"
124-145 REPEAT /note="LRR 4"
148-168 REPEAT /note="LRR 5"
172-193 REPEAT /note="LRR 6"
198-219 REPEAT /note="LRR 7"
222-244 REPEAT /note="LRR 8"
249-270 REPEAT /note="LRR 9"
275-296 REPEAT /note="LRR 10"
299-320 REPEAT /note="LRR 11"
323-344 REPEAT /note="LRR 12"
356-377 REPEAT /note="LRR 13"
380-400 REPEAT /note="LRR 14"
408-429 REPEAT /note="LRR 15"
432-454 REPEAT /note="LRR 16"
465-486 REPEAT /note="LRR 17"
507-528 REPEAT /note="LRR 18"
531-552 REPEAT /note="LRR 19"
563-584 REPEAT /note="LRR 20"
587-608 REPEAT /note="LRR 21"
611-632 REPEAT /note="LRR 22"
645-698 DOMAIN /note="LRRCT"
754-897 DOMAIN /note="TIR"
1-904 DISORDER predicted by DISOPRED

MONOMER
904
pdb_id a1 identity[%]2 description
7c76 A 100.0
3j0a A 31.9
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.