Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3216243 626 166 O00327(BMAL1_HUMAN) RecName: Full=Basic helix-loop-helix ARNT-like protein 1 ;AltName: Full=Aryl hydrocarbon receptor nuclear translocator-like protein 1;AltName: Full=Basic-helix-loop-helix-PAS protein MOP3;AltName: Full=Brain and muscle ARNT-like 1;AltName: Full=Class E basic helix-loop-helix protein 5; Short=bHLHe5;AltName: Full=Member of PAS protein 3;AltName: Full=PAS domain-containing protein 3;AltName: Full=bHLH-PAS protein JAP3;
QUERYSEQ
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHL
ILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGD
PTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O00327(BMAL1_HUMAN)]

626
region name description
1-626 CHAIN /note="Basic helix-loop-helix ARNT-like protein 1" /id="PRO_0000127156"
72-125 DOMAIN /note="bHLH"
143-215 DOMAIN /note="PAS 1"
326-396 DOMAIN /note="PAS 2"
401-444 DOMAIN /note="PAC"
1-60 REGION /note="Disordered"
458-493 REGION /note="Disordered"
508-588 REGION /note="Interaction with CIART"
511-595 REGION /note="Disordered"
1-37 COMPBIAS /note="Polar residues"
38-60 COMPBIAS /note="Basic and acidic residues"
512-532 COMPBIAS /note="Polar residues"
548-574 COMPBIAS /note="Polar residues"
1-626 DISORDER predicted by DISOPRED

MONOMER
626
pdb_id a1 identity[%]2 description
4f3l A 99.3
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.