Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[0.0 %]


[Back to Search Page]

[Back to HOMCOS]


[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1704891 626 160 O00327(BMAL1_HUMAN) RecName: Full=Basic helix-loop-helix ARNT-like protein 1 ;AltName: Full=Aryl hydrocarbon receptor nuclear translocator-like protein 1;AltName: Full=Basic-helix-loop-helix-PAS protein MOP3;AltName: Full=Brain and muscle ARNT-like 1;AltName: Full=Class E basic helix-loop-helix protein 5; Short=bHLHe5;AltName: Full=Member of PAS protein 3;AltName: Full=PAS domain-containing protein 3;AltName: Full=bHLH-PAS protein JAP3;
QUERYSEQ
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHL
ILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGD
PTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O00327(BMAL1_HUMAN)]

626
region name description
1-626 CHAIN /note="Basic helix-loop-helix ARNT-like protein 1" /id="PRO_0000127156"
72-125 DOMAIN /note="bHLH"
143-215 DOMAIN /note="PAS 1"
326-396 DOMAIN /note="PAS 2"
401-444 DOMAIN /note="PAC"
1-60 REGION /note="Disordered"
458-493 REGION /note="Disordered"
508-588 REGION /note="Interaction with CIART"
511-595 REGION /note="Disordered"
1-37 COMPBIAS /note="Polar residues"
38-60 COMPBIAS /note="Basic and acidic residues"
512-532 COMPBIAS /note="Polar residues"
548-574 COMPBIAS /note="Polar residues"
1-626 DISORDER predicted by DISOPRED

MONOMER
626
pdb_id a1 identity[%]2 description
4f3l A 99.3 Q6F6D6_MOUSE BMAL1b
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4h10[1] B CLOCK_HUMAN Circadian locomoter output cycles protein kaput[63.. A 100.0
/100.0
13
/13
BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..
8osj[2] K CLOCK_MOUSE Circadian locomoter output cycles protein kaput[63.. L 100.0
/100.0
3
/3
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
8osj[1] C H2A1B_HUMAN Histone H2A type 1-B/E[100 aa] L 100.0
/100.0
2
/2
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
4f3l[1] B CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. A 100.0
/99.3
84
/84
Q6F6D6_MOUSE BMAL1b
8osk[2] K CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. L 100.0
/99.3
12
/12
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
5nj8[1] C AHR_HUMAN Aryl hydrocarbon receptor[176 aa] D 81.5
/62.1
27
/29
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7xhv[1] B NPAS4_MOUSE Neuronal PAS domain-containing protein 4[192 aa] A 80.5
/61.4
41
/41
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[1] A AHR_HUMAN Aryl hydrocarbon receptor[176 aa] B 82.9
/60.1
41
/41
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5v0l[1] B AHR_MOUSE Aryl hydrocarbon receptor[166 aa] A 88.2
/59.1
34
/34
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
4zpr[1] B HIF1A_MOUSE Hypoxia-inducible factor 1-alpha[279 aa] A 82.4
/53.9
51
/51
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5y7y[1] A AHRR_HUMAN Aryl hydrocarbon receptor repressor[201 aa] B 76.8
/52.1
56
/56
ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator
7xi3[2] B A1L327_MOUSE Neuronal PAS domain protein 4[314 aa] A 73.6
/48.6
53
/53
Aryl hydrocarbon receptor nuclear translocator 2
4zpk[1] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[321 aa.. A 79.1
/51.3
67
/67
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5sy7[1] B NPAS3_MOUSE Neuronal PAS domain-containing protein 3[276 aa] A 70.3
/50.7
74
/76
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
4zp4[10] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[295 aa.. A 77.6
/50.2
58
/58
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5sy5[3] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] A 74.0
/49.4
77
/80
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5sy5[1] D NPAS1_MOUSE Neuronal PAS domain-containing protein 1[283 aa] A 45.5
/49.4
11
/11
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5sy5[1] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] E 40.0
/50.2
5
/5
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7v7l[2] B HIF3A_MOUSE Hypoxia-inducible factor 3-alpha[299 aa] A 72.0
/48.4
75
/75
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
4pky[2] B TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 64.3
/38.4
14
/14
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
4pky[2] C TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 40.0
/38.4
5
/6
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
4f3l[1] A Q6F6D6_MOUSE BMAL1b[302 aa] B 35.3
/39.1
85
/88
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
8osk[2] L BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1[285 aa].. K 38.5
/38.4
13
/13
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
8osk[2] E H31_HUMAN Histone H3.1[94 aa] K 50.0
/38.4
2
/2
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
7vni[2] A O61543_DROME Ahr homolog spineless[110 aa] B 72.7
/38.8
11
/11
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
4lpz[4] C Transforming acidic coiled-coil-containing protein.. A 83.3
/38.9
6
/6
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
8osk[1] H H2B1J_HUMAN Histone H2B type 1-J[94 aa] K 100.0
/38.4
1
/1
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
5nj8[1] D ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[134.. C 48.0
/38.3
25
/35
AHR_HUMAN Aryl hydrocarbon receptor
2a24[1] A EPAS1_HUMAN Endothelial PAS domain protein 1[107 aa] B 62.5
/38.8
24
/25
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
3f1n[22] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[108 aa.. B 52.6
/38.2
19
/21
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
5tbm[2] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[106 aa.. B 20.0
/38.2
10
/10
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
6czw[3] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[109 aa.. B 30.0
/38.2
10
/10
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
4h6j[1] A HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA[106 aa] B 62.5
/38.2
16
/18
ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR
5v0l[1] A ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[176.. B 31.4
/36.6
35
/44
AHR_MOUSE Aryl hydrocarbon receptor
4zpr[1] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[235.. B 41.2
/36.5
51
/52
HIF1A_MOUSE Hypoxia-inducible factor 1-alpha
5nj8[1] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[174.. A 36.4
/36.5
33
/43
AHR_HUMAN Aryl hydrocarbon receptor
7xi3[1] A Aryl hydrocarbon receptor nuclear translocator 2[2.. B 47.2
/35.6
36
/61
A1L327_MOUSE Neuronal PAS domain protein 4
4zp4[11] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[261.. B 35.9
/33.6
64
/66
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
7xhv[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[177.. B 43.6
/34.8
39
/47
NPAS4_MOUSE Neuronal PAS domain-containing protein 4
5y7y[1] B ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator[263.. A 26.0
/34.2
50
/63
AHRR_HUMAN Aryl hydrocarbon receptor repressor
5sy5[4] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. B 38.6
/36.8
70
/83
NPAS1_MOUSE Neuronal PAS domain-containing protein 1
5sy5[2] E ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[279.. B 33.3
/36.8
3
/3
NPAS1_MOUSE Neuronal PAS domain-containing protein 1
2a24[1] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 25.0
/32.7
24
/26
EPAS1_HUMAN Endothelial PAS domain protein 1
3f1n[22] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[112.. A 20.0
/33.3
10
/18
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
4h6j[1] B ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR[111 aa] A 13.3
/34.6
15
/15
HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA
5tbm[5] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[110.. A 36.4
/32.4
11
/11
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
7vni[2] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[104.. A 45.5
/33.3
11
/11
O61543_DROME Ahr homolog spineless
7v7l[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[280.. B 30.8
/31.2
65
/76
HIF3A_MOUSE Hypoxia-inducible factor 3-alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4h10[1] C E-box DNA sense strand A 100.0
/100.0
9
/9
BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..
4h10[1] D E-box DNA antisense strand A 100.0
/100.0
4
/4
BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..
8osj[1] J DNA (124-MER) L 100.0
/100.0
2
/2
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
8osl[1] I DNA (147-MER) K 83.3
/38.9
6
/6
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
8osl[1] I DNA (147-MER) N 100.0
/100.0
5
/5
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
8osl[1] J DNA (147-MER) K 100.0
/38.9
1
/1
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
8osl[1] J DNA (147-MER) L 100.0
/99.3
7
/7
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
8osk[1] J DNA (124-MER) L 100.0
/99.3
4
/4
BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1
5nj8[2] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. A 100.0
/36.5
5
/7
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[2] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. B 100.0
/60.1
4
/4
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[2] F DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. A 33.3
/36.5
3
/3
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[2] F DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. B 80.0
/60.1
10
/11
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
8osk[1] I DNA (124-MER) K 100.0
/38.4
2
/2
CLOCK_MOUSE Circadian locomoter output cycles protein kaput
5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. A 87.5
/59.1
8
/8
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. B 75.0
/36.6
4
/4
AHR_MOUSE Aryl hydrocarbon receptor
5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. A 100.0
/59.1
1
/1
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. B 100.0
/36.6
2
/2
AHR_MOUSE Aryl hydrocarbon receptor
7xhv[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 85.7
/61.4
7
/7
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7xhv[2] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. B 100.0
/34.8
1
/3
NPAS4_MOUSE Neuronal PAS domain-containing protein 4
7xi3[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 77.8
/48.6
9
/9
Aryl hydrocarbon receptor nuclear translocator 2
7xhv[5] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 80.0
/61.4
5
/5
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7xi3[1] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 100.0
/48.6
4
/4
Aryl hydrocarbon receptor nuclear translocator 2
7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. A 77.8
/52.0
9
/9
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. B 100.0
/34.8
1
/2
A1L327_MOUSE Neuronal PAS domain protein 4
4zpk[3] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. A 77.8
/51.3
9
/9
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
4zpk[1] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 66.7
/32.3
3
/5
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
4zpr[2] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 50.0
/36.5
2
/4
HIF1A_MOUSE Hypoxia-inducible factor 1-alpha
4zpk[6] D DNA (5'-D(*CP*AP*CP*GP*AP*CP*CP*CP*GP*CP*AP*CP*GP*.. A 100.0
/51.3
3
/3
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
7d8t[1] A DNA (5'-D(P*GP*GP*GP*AP*CP*AP*CP*AP*TP*GP*TP*TP*AP.. C 100.0
/29.3
3
/3
MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..
7d8t[1] A DNA (5'-D(P*GP*GP*GP*AP*CP*AP*CP*AP*TP*GP*TP*TP*AP.. D 57.1
/29.3
7
/7
MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..
7d8t[1] B DNA (5'-D(*TP*GP*TP*AP*AP*CP*AP*TP*GP*TP*GP*TP*CP*.. C 50.0
/29.3
8
/8
MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..
7d8t[1] B DNA (5'-D(*TP*GP*TP*AP*AP*CP*AP*TP*GP*TP*GP*TP*CP*.. D 75.0
/29.3
4
/4
MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4eq1[2] C PE5
3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL[14 atom..
A 75.0
/38.8
4
/4
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
5tbm[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl)..
A 38.1
/32.4
21
/21
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6e3s[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl)..
B 38.1
/34.3
21
/21
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
6e3t[1] C HO7
(6S)-6-(4-bromophenyl)-2,3,5,6-tetrahydroimidazo[2..
B 30.8
/34.1
13
/13
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
3h7w[1] C 018
2-nitro-N-(thiophen-3-ylmethyl)-4-(trifluoromethyl..
A 35.7
/33.3
14
/17
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
4gs9[1] D PE8
3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL[25 a..
A 80.0
/33.3
5
/5
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
4zph[1] E PRL
PROFLAVIN[16 atoms]
A 50.0
/50.4
2
/2
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
4zph[1] E PRL
PROFLAVIN[16 atoms]
B 20.0
/33.3
5
/5
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
6x21[1] C UKJ
1-(3-bromo-5-fluorophenoxy)-4-[(difluoromethyl)sul..
A 38.9
/33.3
18
/22
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6x3d[1] C ULM
(6R,7S)-4-[(3,3-difluorocyclobutyl)oxy]-6-fluoro-1..
A 41.2
/33.3
17
/21
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
7w80[1] C 72Q
3-{[(1S,2S,3R)-2,3-difluoro-1-hydroxy-7-(methylsul..
B 40.9
/33.2
22
/22
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
6e3u[1] C HNJ
3-{[2-(pyrrolidin-1-yl)phenyl]amino}-1H-1lambda~6~..
B 47.1
/33.1
17
/17
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
4ghi[1] C 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad..
A 37.5
/33.3
16
/19
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
4zqd[1] E 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad..
B 40.0
/33.0
15
/15
EPAS1_MOUSE Endothelial PAS domain-containing protein 1
5ufp[1] C 86D
3-({(1S)-7-[(difluoromethyl)sulfonyl]-2,2-difluoro..
A 38.1
/32.4
21
/21
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6czw[1] C FO7
{2-bromo-3-(3-chloro-5-fluorophenoxy)-6-[(difluoro..
A 40.9
/32.4
22
/22
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6d09[1] C FOJ
3-{[(3R)-4-(difluoromethyl)-2,2-difluoro-3-hydroxy..
A 38.1
/32.4
21
/21
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6d0b[1] C FOV
N-(3-chloro-5-fluorophenyl)-2-nitro-4-[(trifluorom..
A 39.1
/32.4
23
/23
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6x28[1] C ULG
(1R)-4-(3,5-difluorophenoxy)-7-(trifluoromethyl)-2..
A 40.9
/32.4
22
/22
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6x2h[1] C ULD
cis-3-({(1S)-7-[dihydroxy(trifluoromethyl)-lambda~..
A 38.1
/32.4
21
/21
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
8ck8[1] C UYF
(4~{S})-1-cyclohexyloxy-5,5-bis(fluoranyl)-3-methy..
A 36.8
/32.4
19
/19
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
7vnh[2] C BHF
2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE[21 atoms]
A 38.5
/32.5
13
/14
O61543_DROME Ahr homolog spineless
8ck3[1] C UXU
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor..
A 40.0
/32.0
20
/20
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
4xt2[2] E 43L
(5S,7R)-5,7-bis(3-bromophenyl)-4,5,6,7-tetrahydrot..
C 40.0
/31.8
20
/20
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
7v7w[1] C 5YM
(Z)-N-(2-hydroxyethyl)octadec-9-enamide[23 atoms]
B 50.0
/31.7
10
/15
HIF3A_MOUSE Hypoxia-inducible factor 3-alpha
3f1o[1] C 2XY
N-[2-nitro-4-(trifluoromethyl)phenyl]morpholin-4-a..
A 42.1
/31.7
19
/19
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
6x37[1] C ULS
3-fluoro-5-{[(7R)-7-hydroxy-1-(trifluoromethyl)-6,..
A 35.0
/31.7
20
/20
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
8ck4[1] C UY3
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor..
A 42.1
/31.7
19
/19
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
3h82[1] C 020
N-(furan-2-ylmethyl)-2-nitro-4-(trifluoromethyl)an..
B 42.1
/31.1
19
/19
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nj8[2] I ER3
ERBIUM (III) ION[1 atoms]
A 0.0
/36.5
1
/1
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[1] J ER3
ERBIUM (III) ION[1 atoms]
A 100.0
/36.5
2
/2
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[2] L ER3
ERBIUM (III) ION[1 atoms]
A 100.0
/36.5
1
/1
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[1] J ER3
ERBIUM (III) ION[1 atoms]
B 100.0
/60.1
1
/1
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[1] M ER3
ERBIUM (III) ION[1 atoms]
B 0.0
/60.1
1
/1
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[2] N ER3
ERBIUM (III) ION[1 atoms]
B 100.0
/60.1
1
/1
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[1] O ER3
ERBIUM (III) ION[1 atoms]
B 100.0
/60.1
1
/2
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[1] P ER3
ERBIUM (III) ION[1 atoms]
B 0.0
/60.1
1
/1
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5nj8[1] T ER3
ERBIUM (III) ION[1 atoms]
D 50.0
/62.1
2
/2
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5sy5[1] C ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[269.. A 0.0
/49.4
2
/2
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
5sy5[1] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. C 100.0
/49.0
1
/1
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
2hv1[2] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 60.0
/38.8
15
/18
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
4eq1[2] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[109.. A 43.8
/38.8
16
/19
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
3gdi[1] A PER2_MOUSE Period circadian protein homolog 2[269 aa] B 30.0
/33.3
20
/23
PER2_MOUSE Period circadian protein homolog 2
4dj3[1] A PER3_MOUSE Period circadian protein homolog 3[298 aa] B 36.4
/32.3
11
/12
PER3_MOUSE Period circadian protein homolog 3
1wa9[1] A PER_DROME PERIOD CIRCADIAN PROTEIN[318 aa] B 32.0
/32.0
25
/45
PER_DROME PERIOD CIRCADIAN PROTEIN
1wa9[1] B PER_DROME PERIOD CIRCADIAN PROTEIN[319 aa] A 26.5
/30.3
34
/48
PER_DROME PERIOD CIRCADIAN PROTEIN
3rty[8] B PER_DROME Period circadian protein[302 aa] A 25.8
/30.6
31
/48
PER_DROME Period circadian protein
4dj3[1] B PER3_MOUSE Period circadian protein homolog 3[265 aa] A 50.0
/31.0
14
/15
PER3_MOUSE Period circadian protein homolog 3
3gdi[1] B PER2_MOUSE Period circadian protein homolog 2[250 aa] A 31.2
/30.7
16
/24
PER2_MOUSE Period circadian protein homolog 2
7d8t[2] D MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met.. C 36.4
/29.3
22
/22
MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..
4dj2[4] C PER1_MOUSE Period circadian protein homolog 1[264 aa] A 36.4
/28.2
11
/15
PER1_MOUSE Period circadian protein homolog 1
8gci[2] A PER_CAEEL Period protein homolog lin-42[169 aa] A 45.5
/21.8
11
/11
PER_CAEEL Period protein homolog lin-42
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
626 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5nj8[1] K ACT
ACETATE ION[4 atoms]
A 100.0
/36.5
1
/1
AHR_HUMAN Aryl hydrocarbon receptor
5nj8[1] K ACT
ACETATE ION[4 atoms]
B 50.0
/60.1
2
/2
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
3f1n[1] C EDO
1,2-ETHANEDIOL[4 atoms]
A 50.0
/33.3
6
/8
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
3f1n[1] D EDO
1,2-ETHANEDIOL[4 atoms]
A 0.0
/33.3
6
/7
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
3f1n[2] E EDO
1,2-ETHANEDIOL[4 atoms]
A 40.0
/33.3
5
/5
EPAS1_HUMAN Endothelial PAS domain-containing protein 1
5f5y[2] B EDO
1,2-ETHANEDIOL[4 atoms]
A 80.0
/54.5
10
/10
CYCL_DROME Protein cycle
5f69[1] B GOL
GLYCEROL[6 atoms]
A 81.8
/53.5
11
/11
CYCL_DROME Protein cycle
5y7y[1] C GOL
GLYCEROL[6 atoms]
A 0.0
/34.2
6
/9
AHRR_HUMAN Aryl hydrocarbon receptor repressor
5y7y[1] D GOL
GLYCEROL[6 atoms]
A 0.0
/34.2
1
/4
AHRR_HUMAN Aryl hydrocarbon receptor repressor
5y7y[1] E GOL
GLYCEROL[6 atoms]
B 50.0
/52.1
2
/2
ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator
8ck3[1] D DMS
DIMETHYL SULFOXIDE[4 atoms]
B 14.3
/38.2
7
/7
ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator
5v0l[1] F CIT
CITRIC ACID[13 atoms]
B 0.0
/36.6
1
/1
AHR_MOUSE Aryl hydrocarbon receptor
4wn5[1] C SO4
SULFATE ION[5 atoms]
A 100.0
/31.1
1
/6
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha
7vni[2] E SO4
SULFATE ION[5 atoms]
A 0.0
/33.3
1
/2
O61543_DROME Ahr homolog spineless
7vni[1] F SO4
SULFATE ION[5 atoms]
A 0.0
/33.3
2
/2
O61543_DROME Ahr homolog spineless
7vni[1] F SO4
SULFATE ION[5 atoms]
B 66.7
/38.8
3
/3
ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator
3rty[8] I DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 50.0
/30.6
8
/8
PER_DROME Period circadian protein
3rty[8] J DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 0.0
/30.6
3
/3
PER_DROME Period circadian protein
3rty[5] L DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 33.3
/30.6
3
/3
PER_DROME Period circadian protein
3rty[2] O DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms]
A 0.0
/30.6
1
/1
PER_DROME Period circadian protein
4wn5[2] D MVC
MONOVACCENIN[25 atoms]
A 41.7
/31.1
12
/18
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha
4wn5[1] E P6G
HEXAETHYLENE GLYCOL[19 atoms]
A 0.0
/31.1
1
/4
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha
4wn5[2] F P6G
HEXAETHYLENE GLYCOL[19 atoms]
A 50.0
/31.1
2
/3
HIF3A_HUMAN Hypoxia-inducible factor 3-alpha
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.