HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

1223515

626

166

O00327(BMAL1_HUMAN)

RecName: Full=Basic helix-loop-helix ARNT-like protein 1 ;AltName: Full=Aryl hydrocarbon receptor nuclear translocator-like protein 1;AltName: Full=Basic-helix-loop-helix-PAS protein MOP3;AltName: Full=Brain and muscle ARNT-like 1;AltName: Full=Class E basic helix-loop-helix protein 5; Short=bHLHe5;AltName: Full=Member of PAS protein 3;AltName: Full=PAS domain-containing protein 3;AltName: Full=bHLH-PAS protein JAP3;

QUERYSEQ

MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHL
ILRAADGFLFVVGCDRGKILFVSESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLCSGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVLANVLEGGD
PTFPQLTASPHSMDSMLPSGEGGPKRTHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [O00327(BMAL1_HUMAN)]

626
	region	name	description
	1-626	CHAIN	/note="Basic helix-loop-helix ARNT-like protein 1" /id="PRO_0000127156"
	72-125	DOMAIN	/note="bHLH"
	143-215	DOMAIN	/note="PAS 1"
	326-396	DOMAIN	/note="PAS 2"
	401-444	DOMAIN	/note="PAC"
	1-60	REGION	/note="Disordered"
	458-493	REGION	/note="Disordered"
	508-588	REGION	/note="Interaction with CIART"
	511-595	REGION	/note="Disordered"
	1-37	COMPBIAS	/note="Polar residues"
	38-60	COMPBIAS	/note="Basic and acidic residues"
	512-532	COMPBIAS	/note="Polar residues"
	548-574	COMPBIAS	/note="Polar residues"
	1-626	DISORDER	predicted by DISOPRED

MONOMER

626

pdb_id a¹ identity[%]² description

4f3l A 99.3 Q6F6D6_MOUSE BMAL1b

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4h10[1] B CLOCK_HUMAN Circadian locomoter output cycles protein kaput[63.. A 100.0
/100.0 13
/13 BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..

8osj[2] K CLOCK_MOUSE Circadian locomoter output cycles protein kaput[63.. L 100.0
/100.0 3
/3 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osj[1] C H2A1B_HUMAN Histone H2A type 1-B/E[100 aa] L 100.0
/100.0 2
/2 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

4f3l[1] B CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. A 100.0
/99.3 84
/84 Q6F6D6_MOUSE BMAL1b

8osk[2] K CLOCK_MOUSE Circadian locomoter output cycles protein kaput[31.. L 100.0
/99.3 12
/12 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

5nj8[1] C AHR_HUMAN Aryl hydrocarbon receptor[176 aa] D 81.5
/62.1 27
/29 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xhv[1] B NPAS4_MOUSE Neuronal PAS domain-containing protein 4[192 aa] A 80.5
/61.4 41
/41 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] A AHR_HUMAN Aryl hydrocarbon receptor[176 aa] B 82.9
/60.1 41
/41 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5v0l[1] B AHR_MOUSE Aryl hydrocarbon receptor[166 aa] A 88.2
/59.1 34
/34 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4zpr[1] B HIF1A_MOUSE Hypoxia-inducible factor 1-alpha[279 aa] A 82.4
/53.9 51
/51 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5y7y[1] A AHRR_HUMAN Aryl hydrocarbon receptor repressor[201 aa] B 76.8
/52.1 56
/56 ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator

7xi3[2] B A1L327_MOUSE Neuronal PAS domain protein 4[314 aa] A 73.6
/48.6 53
/53 Aryl hydrocarbon receptor nuclear translocator 2

4zpk[1] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[321 aa.. A 79.1
/51.3 67
/67 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy7[1] B NPAS3_MOUSE Neuronal PAS domain-containing protein 3[276 aa] A 70.3
/50.7 74
/76 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zp4[10] B EPAS1_MOUSE Endothelial PAS domain-containing protein 1[295 aa.. A 77.6
/50.2 58
/58 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[3] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] A 74.0
/49.4 77
/80 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[1] D NPAS1_MOUSE Neuronal PAS domain-containing protein 1[283 aa] A 45.5
/49.4 11
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[1] B NPAS1_MOUSE Neuronal PAS domain-containing protein 1[278 aa] E 40.0
/50.2 5
/5 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7v7l[2] B HIF3A_MOUSE Hypoxia-inducible factor 3-alpha[299 aa] A 72.0
/48.4 75
/75 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4pky[2] B TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 64.3
/38.4 14
/14 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4pky[2] C TACC3_MOUSE Transforming acidic coiled-coil-containing protein.. A 40.0
/38.4 5
/6 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4f3l[1] A Q6F6D6_MOUSE BMAL1b[302 aa] B 35.3
/39.1 85
/88 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osk[2] L BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1[285 aa].. K 38.5
/38.4 13
/13 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osk[2] E H31_HUMAN Histone H3.1[94 aa] K 50.0
/38.4 2
/2 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

7vni[2] A O61543_DROME Ahr homolog spineless[110 aa] B 72.7
/38.8 11
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4lpz[4] C Transforming acidic coiled-coil-containing protein.. A 83.3
/38.9 6
/6 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

8osk[1] H H2B1J_HUMAN Histone H2B type 1-J[94 aa] K 100.0
/38.4 1
/1 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

5nj8[1] D ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[134.. C 48.0
/38.3 25
/35 AHR_HUMAN Aryl hydrocarbon receptor

2a24[1] A EPAS1_HUMAN Endothelial PAS domain protein 1[107 aa] B 62.5
/38.8 24
/25 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

3f1n[22] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[108 aa.. B 52.6
/38.2 19
/21 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5tbm[2] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[106 aa.. B 20.0
/38.2 10
/10 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

6czw[3] A EPAS1_HUMAN Endothelial PAS domain-containing protein 1[109 aa.. B 30.0
/38.2 10
/10 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4h6j[1] A HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA[106 aa] B 62.5
/38.2 16
/18 ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR

5v0l[1] A ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[176.. B 31.4
/36.6 35
/44 AHR_MOUSE Aryl hydrocarbon receptor

4zpr[1] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[235.. B 41.2
/36.5 51
/52 HIF1A_MOUSE Hypoxia-inducible factor 1-alpha

5nj8[1] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[174.. A 36.4
/36.5 33
/43 AHR_HUMAN Aryl hydrocarbon receptor

7xi3[1] A Aryl hydrocarbon receptor nuclear translocator 2[2.. B 47.2
/35.6 36
/61 A1L327_MOUSE Neuronal PAS domain protein 4

4zp4[11] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[261.. B 35.9
/33.6 64
/66 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

7xhv[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[177.. B 43.6
/34.8 39
/47 NPAS4_MOUSE Neuronal PAS domain-containing protein 4

5y7y[1] B ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator[263.. A 26.0
/34.2 50
/63 AHRR_HUMAN Aryl hydrocarbon receptor repressor

5sy5[4] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. B 38.6
/36.8 70
/83 NPAS1_MOUSE Neuronal PAS domain-containing protein 1

5sy5[2] E ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[279.. B 33.3
/36.8 3
/3 NPAS1_MOUSE Neuronal PAS domain-containing protein 1

2a24[1] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 25.0
/32.7 24
/26 EPAS1_HUMAN Endothelial PAS domain protein 1

3f1n[22] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[112.. A 20.0
/33.3 10
/18 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4h6j[1] B ARNT_HUMAN ARYL HYDROCARBON NUCLEAR TRANSLOCATOR[111 aa] A 13.3
/34.6 15
/15 HIF1A_HUMAN HYPOXIA INDUCIBLE FACTOR 1-ALPHA

5tbm[5] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[110.. A 36.4
/32.4 11
/11 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

7vni[2] B ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[104.. A 45.5
/33.3 11
/11 O61543_DROME Ahr homolog spineless

7v7l[2] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[280.. B 30.8
/31.2 65
/76 HIF3A_MOUSE Hypoxia-inducible factor 3-alpha

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

NUCLEOTIDE

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4h10[1] C E-box DNA sense strand A 100.0
/100.0 9
/9 BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..

4h10[1] D E-box DNA antisense strand A 100.0
/100.0 4
/4 BMAL1_HUMAN Aryl hydrocarbon receptor nuclear translocator-lik..

8osj[1] J DNA (124-MER) L 100.0
/100.0 2
/2 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osl[1] I DNA (147-MER) K 83.3
/38.9 6
/6 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osl[1] I DNA (147-MER) N 100.0
/100.0 5
/5 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osl[1] J DNA (147-MER) K 100.0
/38.9 1
/1 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8osl[1] J DNA (147-MER) L 100.0
/99.3 7
/7 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

8osk[1] J DNA (124-MER) L 100.0
/99.3 4
/4 BMAL1_MOUSE Basic helix-loop-helix ARNT-like protein 1

5nj8[2] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. A 100.0
/36.5 5
/7 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[2] E DNA (5'-D(*GP*GP*TP*CP*AP*CP*GP*CP*AP*AP*CP*C)-3').. B 100.0
/60.1 4
/4 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[2] F DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. A 33.3
/36.5 3
/3 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[2] F DNA (5'-D(*GP*GP*TP*TP*GP*CP*GP*TP*GP*AP*CP*C)-3').. B 80.0
/60.1 10
/11 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

8osk[1] I DNA (124-MER) K 100.0
/38.4 2
/2 CLOCK_MOUSE Circadian locomoter output cycles protein kaput

8ia3[1] C DNA (5'-D(P*GP*AP*CP*GP*GP*GP*CP*AP*CP*GP*TP*GP*AP.. A 66.7
/37.5 9
/9 USF2_HUMAN Upstream stimulatory factor 2

8ia3[1] C DNA (5'-D(P*GP*AP*CP*GP*GP*GP*CP*AP*CP*GP*TP*GP*AP.. B 66.7
/37.5 6
/6 USF2_HUMAN Upstream stimulatory factor 2

8ia3[1] D DNA (5'-D(*GP*CP*GP*CP*GP*TP*CP*AP*CP*GP*TP*GP*CP*.. A 71.4
/37.5 7
/7 USF2_HUMAN Upstream stimulatory factor 2

8ia3[1] D DNA (5'-D(*GP*CP*GP*CP*GP*TP*CP*AP*CP*GP*TP*GP*CP*.. B 66.7
/37.5 9
/9 USF2_HUMAN Upstream stimulatory factor 2

8ia3[1] G DNA (5'-D(P*GP*AP*CP*GP*GP*GP*CP*AP*CP*GP*TP*GP*AP.. E 63.6
/37.5 11
/11 USF2_HUMAN Upstream stimulatory factor 2

8ia3[1] G DNA (5'-D(P*GP*AP*CP*GP*GP*GP*CP*AP*CP*GP*TP*GP*AP.. F 66.7
/37.5 6
/6 USF2_HUMAN Upstream stimulatory factor 2

8ia3[2] H DNA (5'-D(*GP*CP*GP*CP*GP*TP*CP*AP*CP*GP*TP*GP*CP*.. E 75.0
/37.5 4
/4 USF2_HUMAN Upstream stimulatory factor 2

5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. A 87.5
/59.1 8
/8 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5v0l[1] C DNA (5'-D(P*GP*GP*AP*TP*TP*GP*CP*GP*TP*GP*AP*GP*AP.. B 75.0
/36.6 4
/4 AHR_MOUSE Aryl hydrocarbon receptor

5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. A 100.0
/59.1 1
/1 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5v0l[1] D DNA (5'-D(P*AP*GP*TP*TP*CP*TP*CP*AP*CP*GP*CP*AP*AP.. B 100.0
/36.6 2
/2 AHR_MOUSE Aryl hydrocarbon receptor

7xhv[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 85.7
/61.4 7
/7 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xhv[2] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. B 100.0
/34.8 1
/3 NPAS4_MOUSE Neuronal PAS domain-containing protein 4

7xi3[1] C DNA (5'-D(P*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP.. A 77.8
/48.6 9
/9 Aryl hydrocarbon receptor nuclear translocator 2

7xhv[5] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 80.0
/61.4 5
/5 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xi3[1] D DNA (5'-D(P*CP*CP*AP*TP*CP*AP*CP*TP*CP*AP*CP*GP*AP.. A 100.0
/48.6 4
/4 Aryl hydrocarbon receptor nuclear translocator 2

7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. A 77.8
/52.0 9
/9 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7xi4[1] C DNA (5'-D(*GP*GP*AP*GP*GP*TP*CP*GP*TP*GP*AP*GP*TP*.. B 100.0
/34.8 1
/2 A1L327_MOUSE Neuronal PAS domain protein 4

4zpk[3] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. A 77.8
/51.3 9
/9 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zpk[1] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 66.7
/32.3 3
/5 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

4zpr[2] C DNA (5'-D(*GP*GP*CP*TP*GP*CP*GP*TP*AP*CP*GP*TP*GP*.. B 50.0
/36.5 2
/4 HIF1A_MOUSE Hypoxia-inducible factor 1-alpha

4zpk[6] D DNA (5'-D(*CP*AP*CP*GP*AP*CP*CP*CP*GP*CP*AP*CP*GP*.. A 100.0
/51.3 3
/3 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

7d8t[1] A DNA (5'-D(P*GP*GP*GP*AP*CP*AP*CP*AP*TP*GP*TP*TP*AP.. C 100.0
/29.3 3
/3 MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..

7d8t[1] A DNA (5'-D(P*GP*GP*GP*AP*CP*AP*CP*AP*TP*GP*TP*TP*AP.. D 57.1
/29.3 7
/7 MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..

7d8t[1] B DNA (5'-D(*TP*GP*TP*AP*AP*CP*AP*TP*GP*TP*GP*TP*CP*.. C 50.0
/29.3 8
/8 MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..

7d8t[1] B DNA (5'-D(*TP*GP*TP*AP*AP*CP*AP*TP*GP*TP*GP*TP*CP*.. D 75.0
/29.3 4
/4 MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

4eq1[2] C PE5
3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL[14 atom.. A 75.0
/38.8 4
/4 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

8g4a[2] C YL8
5-[3,5-bis(trifluoromethyl)phenyl]-2H-tetrazole[19.. A 66.7
/38.8 6
/6 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5tbm[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl).. A 38.1
/32.4 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6e3s[1] C 79A
3-{[(1S)-2,2-difluoro-1-hydroxy-7-(methylsulfonyl).. B 38.1
/34.3 21
/21 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

6e3t[1] C HO7
(6S)-6-(4-bromophenyl)-2,3,5,6-tetrahydroimidazo[2.. B 30.8
/34.1 13
/13 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

3h7w[1] C 018
2-nitro-N-(thiophen-3-ylmethyl)-4-(trifluoromethyl.. A 35.7
/33.3 14
/17 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4gs9[1] D PE8
3,6,9,12,15,18,21-HEPTAOXATRICOSANE-1,23-DIOL[25 a.. A 80.0
/33.3 5
/5 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4zph[1] E PRL
PROFLAVIN[16 atoms] A 50.0
/50.4 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

4zph[1] E PRL
PROFLAVIN[16 atoms] B 20.0
/33.3 5
/5 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

6x21[1] C UKJ
1-(3-bromo-5-fluorophenoxy)-4-[(difluoromethyl)sul.. A 38.9
/33.3 18
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x3d[1] C ULM
(6R,7S)-4-[(3,3-difluorocyclobutyl)oxy]-6-fluoro-1.. A 41.2
/33.3 17
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

7w80[1] C 72Q
3-{[(1S,2S,3R)-2,3-difluoro-1-hydroxy-7-(methylsul.. B 40.9
/33.2 22
/22 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

6e3u[1] C HNJ
3-{[2-(pyrrolidin-1-yl)phenyl]amino}-1H-1lambda~6~.. B 47.1
/33.1 17
/17 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

4ghi[1] C 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad.. A 37.5
/33.3 16
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4zqd[1] E 0X3
N-(3-chloro-5-fluorophenyl)-4-nitro-2,1,3-benzoxad.. B 40.0
/33.0 15
/15 EPAS1_MOUSE Endothelial PAS domain-containing protein 1

5ufp[1] C 86D
3-({(1S)-7-[(difluoromethyl)sulfonyl]-2,2-difluoro.. A 38.1
/32.4 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6czw[1] C FO7
{2-bromo-3-(3-chloro-5-fluorophenoxy)-6-[(difluoro.. A 40.9
/32.4 22
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6d09[1] C FOJ
3-{[(3R)-4-(difluoromethyl)-2,2-difluoro-3-hydroxy.. A 38.1
/32.4 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6d0b[1] C FOV
N-(3-chloro-5-fluorophenyl)-2-nitro-4-[(trifluorom.. A 39.1
/32.4 23
/23 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x28[1] C ULG
(1R)-4-(3,5-difluorophenoxy)-7-(trifluoromethyl)-2.. A 40.9
/32.4 22
/22 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x2h[1] C ULD
cis-3-({(1S)-7-[dihydroxy(trifluoromethyl)-lambda~.. A 38.1
/32.4 21
/21 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

8ck8[1] C UYF
(4~{S})-1-cyclohexyloxy-5,5-bis(fluoranyl)-3-methy.. A 36.8
/32.4 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

7vnh[2] C BHF
2-PHENYL-4H-BENZO[H]CHROMEN-4-ONE[21 atoms] A 38.5
/32.5 13
/14 O61543_DROME Ahr homolog spineless

8ck3[1] C UXU
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor.. A 40.0
/32.0 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

4xt2[2] E 43L
(5S,7R)-5,7-bis(3-bromophenyl)-4,5,6,7-tetrahydrot.. C 40.0
/31.8 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

7v7w[1] C 5YM
(Z)-N-(2-hydroxyethyl)octadec-9-enamide[23 atoms] B 50.0
/31.7 10
/15 HIF3A_MOUSE Hypoxia-inducible factor 3-alpha

3f1o[1] C 2XY
N-[2-nitro-4-(trifluoromethyl)phenyl]morpholin-4-a.. A 42.1
/31.7 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

6x37[1] C ULS
3-fluoro-5-{[(7R)-7-hydroxy-1-(trifluoromethyl)-6,.. A 35.0
/31.7 20
/20 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

8ck4[1] C UY3
(4~{S})-1-[3,5-bis(fluoranyl)phenyl]-5,5-bis(fluor.. A 42.1
/31.7 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3h82[1] C 020
N-(furan-2-ylmethyl)-2-nitro-4-(trifluoromethyl)an.. B 42.1
/31.1 19
/19 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5nj8[2] I ER3
ERBIUM (III) ION[1 atoms] A 0.0
/36.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] J ER3
ERBIUM (III) ION[1 atoms] A 100.0
/36.5 2
/2 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[2] L ER3
ERBIUM (III) ION[1 atoms] A 100.0
/36.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] J ER3
ERBIUM (III) ION[1 atoms] B 100.0
/60.1 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] M ER3
ERBIUM (III) ION[1 atoms] B 0.0
/60.1 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[2] N ER3
ERBIUM (III) ION[1 atoms] B 100.0
/60.1 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] O ER3
ERBIUM (III) ION[1 atoms] B 100.0
/60.1 1
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] P ER3
ERBIUM (III) ION[1 atoms] B 0.0
/60.1 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5nj8[1] T ER3
ERBIUM (III) ION[1 atoms] D 50.0
/62.1 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5sy5[1] C ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[269.. A 0.0
/49.4 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

5sy5[1] A ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator[278.. C 100.0
/49.0 1
/1 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

2hv1[4] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[108.. A 60.0
/38.8 15
/18 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

4eq1[2] B ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator[109.. A 43.8
/38.8 16
/19 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

8ia3[4] B USF2_HUMAN Upstream stimulatory factor 2[100 aa] A 42.9
/37.5 21
/36 USF2_HUMAN Upstream stimulatory factor 2

8ia3[2] F USF2_HUMAN Upstream stimulatory factor 2[104 aa] A 0.0
/37.5 5
/9 USF2_HUMAN Upstream stimulatory factor 2

8ia3[2] E USF2_HUMAN Upstream stimulatory factor 2[111 aa] B 33.3
/37.5 3
/8 USF2_HUMAN Upstream stimulatory factor 2

8ia3[2] F USF2_HUMAN Upstream stimulatory factor 2[104 aa] B 0.0
/37.5 2
/5 USF2_HUMAN Upstream stimulatory factor 2

3gdi[1] A PER2_MOUSE Period circadian protein homolog 2[269 aa] B 30.0
/33.3 20
/23 PER2_MOUSE Period circadian protein homolog 2

4dj3[1] A PER3_MOUSE Period circadian protein homolog 3[298 aa] B 36.4
/32.3 11
/12 PER3_MOUSE Period circadian protein homolog 3

1wa9[1] A PER_DROME PERIOD CIRCADIAN PROTEIN[318 aa] B 32.0
/32.0 25
/45 PER_DROME PERIOD CIRCADIAN PROTEIN

1wa9[1] B PER_DROME PERIOD CIRCADIAN PROTEIN[319 aa] A 26.5
/30.3 34
/48 PER_DROME PERIOD CIRCADIAN PROTEIN

3rty[8] B PER_DROME Period circadian protein[302 aa] A 25.8
/30.6 31
/48 PER_DROME Period circadian protein

4dj3[1] B PER3_MOUSE Period circadian protein homolog 3[265 aa] A 50.0
/31.0 14
/15 PER3_MOUSE Period circadian protein homolog 3

3gdi[1] B PER2_MOUSE Period circadian protein homolog 2[250 aa] A 31.2
/30.7 16
/24 PER2_MOUSE Period circadian protein homolog 2

7d8t[2] D MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met.. C 36.4
/29.3 22
/22 MITF_HUMAN O66738_AQUAE Microphthalmia-associated transcription factor,Met..

4dj2[4] C PER1_MOUSE Period circadian protein homolog 1[264 aa] A 36.4
/28.2 11
/15 PER1_MOUSE Period circadian protein homolog 1

8gci[2] A PER_CAEEL Period protein homolog lin-42[169 aa] A 45.5
/21.8 11
/11 PER_CAEEL Period protein homolog lin-42

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

626 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5nj8[1] K ACT
ACETATE ION[4 atoms] A 100.0
/36.5 1
/1 AHR_HUMAN Aryl hydrocarbon receptor

5nj8[1] K ACT
ACETATE ION[4 atoms] B 50.0
/60.1 2
/2 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

3f1n[1] C EDO
1,2-ETHANEDIOL[4 atoms] A 50.0
/33.3 6
/8 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3f1n[1] D EDO
1,2-ETHANEDIOL[4 atoms] A 0.0
/33.3 6
/7 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

3f1n[2] E EDO
1,2-ETHANEDIOL[4 atoms] A 40.0
/33.3 5
/5 EPAS1_HUMAN Endothelial PAS domain-containing protein 1

5f5y[2] B EDO
1,2-ETHANEDIOL[4 atoms] A 80.0
/54.5 10
/10 CYCL_DROME Protein cycle

5f69[1] B GOL
GLYCEROL[6 atoms] A 81.8
/53.5 11
/11 CYCL_DROME Protein cycle

5y7y[1] C GOL
GLYCEROL[6 atoms] A 0.0
/34.2 6
/9 AHRR_HUMAN Aryl hydrocarbon receptor repressor

5y7y[1] D GOL
GLYCEROL[6 atoms] A 0.0
/34.2 1
/4 AHRR_HUMAN Aryl hydrocarbon receptor repressor

5y7y[1] E GOL
GLYCEROL[6 atoms] B 50.0
/52.1 2
/2 ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator

8ck3[1] D DMS
DIMETHYL SULFOXIDE[4 atoms] B 14.3
/38.2 7
/7 ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator

5v0l[1] F CIT
CITRIC ACID[13 atoms] B 0.0
/36.6 1
/1 AHR_MOUSE Aryl hydrocarbon receptor

4wn5[1] C SO4
SULFATE ION[5 atoms] A 100.0
/31.1 1
/6 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

7vni[2] E SO4
SULFATE ION[5 atoms] A 0.0
/33.3 1
/2 O61543_DROME Ahr homolog spineless

7vni[1] F SO4
SULFATE ION[5 atoms] A 0.0
/33.3 2
/2 O61543_DROME Ahr homolog spineless

7vni[1] F SO4
SULFATE ION[5 atoms] B 66.7
/38.8 3
/3 ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator

3rty[8] I DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 50.0
/30.6 8
/8 PER_DROME Period circadian protein

3rty[8] J DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 0.0
/30.6 3
/3 PER_DROME Period circadian protein

3rty[5] L DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 33.3
/30.6 3
/3 PER_DROME Period circadian protein

3rty[2] O DTT
2,3-DIHYDROXY-1,4-DITHIOBUTANE[8 atoms] A 0.0
/30.6 1
/1 PER_DROME Period circadian protein

4wn5[2] D MVC
MONOVACCENIN[25 atoms] A 41.7
/31.1 12
/18 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

4wn5[1] E P6G
HEXAETHYLENE GLYCOL[19 atoms] A 0.0
/31.1 1
/4 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

4wn5[2] F P6G
HEXAETHYLENE GLYCOL[19 atoms] A 50.0
/31.1 2
/3 HIF3A_HUMAN Hypoxia-inducible factor 3-alpha

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
626
	pdb_id	a¹	identity[%]²	description
	4f3l	A	99.3	Q6F6D6_MOUSE BMAL1b
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

Contact Molecules for Homologous Proteins

Summary Bars[0.0 %]

UniProt Feature Tables [O00327(BMAL1_HUMAN)]