Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31820 | 84 | 0 | Q80H93(NS8B_SARS) | RecName: Full=ORF8b protein;AltName: Full=Accessory protein 8b;AltName: Full=Non-structural protein 8b; Short=ns8b; |
QUERYSEQ |
MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN |
84 | region | name | description |
1-84 | CHAIN | /note="ORF8b protein" /id="PRO_0000106135" | |
1-82 | DOMAIN | /note="SARS ORF8 Ig-like" | |
1-84 | DISORDER | predicted by DISOPRED |