Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2851321 | 76 | 14 | P59637(VEMP_SARS) | RecName: Full=Envelope small membrane protein ; Short=E protein ; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV |
76 | region | name | description |
1-76 | CHAIN | /note="Envelope small membrane protein" /id="PRO_0000106074" | |
1-16 | TOPO_DOM | /note="Virion surface" | |
17-37 | TRANSMEM | /note="Helical" | |
38-76 | TOPO_DOM | /note="Intravirion" |
MONOMER | |||||||
76 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7k3g | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | E | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7k3g | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | E | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | D | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | C | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8suz | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8u1t | A | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
8u1t | B | 100.0 | VEMP_SARS2 Envelope small membrane protein | ||||
7ntj | D | 100.0 | VEMP_SARS Envelope small membrane protein | ||||
7ntj | B | 100.0 | VEMP_SARS Envelope small membrane protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
76 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7ntj | A | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | B | 100.0 /100.0 |
4 /4 |
VEMP_SARS Envelope small membrane protein | |
7ntj | C | MPP5_HUMAN MAGUK p55 subfamily member 5[86 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS Envelope small membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
76 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7k3g | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
11 /11 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
7k3g | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
12 /12 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | A | 100.0 /100.0 |
3 /3 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | B | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | B | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | C | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | C | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | E | VEMP_SARS2 Envelope small membrane protein[31 aa] | D | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | A | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8suz | D | VEMP_SARS2 Envelope small membrane protein[31 aa] | E | 100.0 /100.0 |
4 /4 |
VEMP_SARS2 Envelope small membrane protein | |
8u1t | B | VEMP_SARS2 Envelope small membrane protein[26 aa] | A | 100.0 /100.0 |
9 /9 |
VEMP_SARS2 Envelope small membrane protein | |
8u1t | A | VEMP_SARS2 Envelope small membrane protein[26 aa] | B | 100.0 /100.0 |
9 /9 |
VEMP_SARS2 Envelope small membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |