Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
23073 | 492 | 51 | O15393(TMPS2_HUMAN) | RecName: Full=Transmembrane protease serine 2 ; EC=3.4.21.122 ;AltName: Full=Serine protease 10 ;Contains: RecName: Full=Transmembrane protease serine 2 non-catalytic chain;Contains: RecName: Full=Transmembrane protease serine 2 catalytic chain;Flags: Precursor; |
QUERYSEQ |
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVR LYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK PLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKN NIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
492 | region | name | description |
1-255 | CHAIN | /note="Transmembrane protease serine 2 non-catalytic chain" /id="PRO_0000027855" | |
256-492 | CHAIN | /note="Transmembrane protease serine 2 catalytic chain" /id="PRO_0000027856" | |
1-84 | TOPO_DOM | /note="Cytoplasmic" | |
85-105 | TRANSMEM | /note="Helical; Signal-anchor for type II membrane protein" | |
106-492 | TOPO_DOM | /note="Extracellular" | |
112-149 | DOMAIN | /note="LDL-receptor class A" | |
150-242 | DOMAIN | /note="SRCR" | |
256-489 | DOMAIN | /note="Peptidase S1" | |
296-296 | ACT_SITE | /note="Charge relay system" | |
345-345 | ACT_SITE | /note="Charge relay system" | |
441-441 | ACT_SITE | /note="Charge relay system" | |
1-492 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
492 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8s0l | A | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8yoy | B | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8yqq | B | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8vgt | B | 99.4 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y1e | D | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y1d | D | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y1e | F | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y1e | E | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y1d | E | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8jhz | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8ji0 | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8s0m | A | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8s0m | B | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
7meq | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8s0n | D | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8s0n | A | 99.7 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
7xyd | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0f | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8hd8 | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0e | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8v1f | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8v1f | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8v04 | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
7y0f | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7xyd | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8hd8 | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0e | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8y8a | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y8a | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y8b | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y8a | F | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y89 | E | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y89 | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y88 | E | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y88 | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y87 | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y7y | B | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y7x | F | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y7x | E | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8y7x | D | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 | ||||
8hd8 | C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0e | C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0e | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7xyd | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8hd8 | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0f | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7xyd | C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
7y0f | C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | ||||
8v1f | C | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chain | ||||
8v1f | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chain | ||||
8v04 | A | 100.0 | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chain | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7xyd | B | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[24.. | A | 100.0 /100.0 |
25 /25 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7xyd | D | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[23.. | C | 100.0 /100.0 |
26 /26 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | B | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[24.. | A | 100.0 /100.0 |
23 /23 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | D | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[23.. | C | 100.0 /100.0 |
25 /25 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | B | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[24.. | A | 100.0 /100.0 |
27 /28 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | D | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[23.. | C | 100.0 /100.0 |
25 /25 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | B | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[24.. | A | 100.0 /100.0 |
24 /25 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | D | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[23.. | C | 100.0 /100.0 |
26 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8v04 | B | TMPS2_HUMAN Transmembrane protease serine 2[238 aa] | A | 100.0 /100.0 |
21 /21 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | B | TMPS2_HUMAN Transmembrane protease serine 2[241 aa] | A | 100.0 /100.0 |
21 /21 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | D | TMPS2_HUMAN Transmembrane protease serine 2[243 aa] | C | 100.0 /100.0 |
22 /22 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
7xyd | A | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | B | 100.0 /100.0 |
26 /28 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | A | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[13.. | B | 100.0 /100.0 |
28 /28 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | A | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | B | 100.0 /100.0 |
30 /32 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | A | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | B | 100.0 /100.0 |
30 /30 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7xyd | C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | D | 100.0 /100.0 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[12.. | D | 100.0 /100.0 |
31 /31 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[13.. | D | 100.0 /100.0 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | C | TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain[13.. | D | 100.0 /100.0 |
32 /32 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8jhz | A | M9ZTT7_PAESO Hemorrhagic toxin[2615 aa] | B | 100.0 /100.0 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8ji0 | B | MALE_ECOLI M9ZTT7_PAESO Maltose/maltodextrin-binding periplasmic protein,H.. | A | 100.0 /100.0 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | A | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | B | 100.0 /100.0 |
24 /24 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | A | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | B | 100.0 /100.0 |
22 /22 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | C | TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | D | 100.0 /100.0 |
27 /27 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1d | A | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | D | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1d | B | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | E | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | A | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | D | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | B | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | E | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | C | SPIKE_CVHN2 Spike glycoprotein[1208 aa] | F | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y87 | D | SPIKE_CVHN5 Spike glycoprotein[1185 aa] | B | 100.0 /100.0 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y88 | C | SPIKE_CVHN5 Spike glycoprotein[1194 aa] | D | 100.0 /100.0 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y88 | B | SPIKE_CVHN5 Spike glycoprotein[1179 aa] | E | 100.0 /100.0 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y89 | B | SPIKE_CVHN5 Spike glycoprotein[1194 aa] | D | 100.0 /100.0 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y89 | C | SPIKE_CVHN5 Spike glycoprotein[1194 aa] | E | 100.0 /100.0 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y8a | D | SPIKE_CVHN5 Spike glycoprotein[1194 aa] | A | 100.0 /100.0 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y8a | E | SPIKE_CVHN5 Spike glycoprotein[1194 aa] | B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y8a | C | SPIKE_CVHN5 Spike glycoprotein[1185 aa] | F | 100.0 /100.0 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y7x | B | SPIKE_CVHN1 Spike glycoprotein[1197 aa] | D | 100.0 /100.0 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y7x | C | SPIKE_CVHN1 Spike glycoprotein[1195 aa] | E | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y7x | A | SPIKE_CVHN1 Spike glycoprotein[1195 aa] | F | 100.0 /100.0 |
10 /10 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0m | D | SPIKE_CVHN5 Spike protein S1[346 aa] | A | 100.0 /99.7 |
17 /17 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0m | E | SPIKE_CVHN5 Spike protein S1[345 aa] | B | 100.0 /99.7 |
16 /16 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y8b | B | SPIKE_CVHN5 Spike glycoprotein[347 aa] | D | 100.0 /100.0 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8yqq | A | SPIKE_CVHN5 Spike protein S1[285 aa] | B | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8vgt | A | SPIKE_CVHN1 Spike protein S1[280 aa] | B | 100.0 /99.4 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y7y | C | SPIKE_CVHN1 Spike glycoprotein[354 aa] | B | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8yoy | A | SPIKE_CVHN1 Spike protein S1[289 aa] | B | 100.0 /99.7 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0m | C | Nanobody A01[131 aa] | A | 100.0 /99.7 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0m | F | Nanobody A01[129 aa] | B | 100.0 /99.7 |
28 /28 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0l | B | Nanobody A07[130 aa] | A | 97.1 /99.7 |
35 /35 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0n | B | nanobody A07[130 aa] | A | 96.6 /99.7 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0n | C | nanobody A07[129 aa] | D | 96.6 /99.7 |
29 /29 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7meq | C |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
A | 100.0 /100.0 |
14 /14 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
7xyd | G |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
B | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7xyd | J |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
D | 100.0 /100.0 |
13 /13 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | G |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
B | 100.0 /100.0 |
14 /14 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | J |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
D | 100.0 /100.0 |
16 /16 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | F |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
B | 100.0 /100.0 |
15 /15 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | I |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
D | 100.0 /100.0 |
16 /16 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8v04 | H |
GBS
4-carbamimidamidobenzoic acid[12 atoms] |
B | 100.0 /100.0 |
16 /16 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
7y0f | G |
I9V
2-[(1-carbamimidamido-4-chloranyl-isoquinolin-7-yl.. |
B | 100.0 /100.0 |
18 /18 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | J |
I9V
2-[(1-carbamimidamido-4-chloranyl-isoquinolin-7-yl.. |
D | 100.0 /100.0 |
18 /18 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8v1f | G |
TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms] |
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | N |
TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms] |
B | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | P |
TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms] |
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | EA |
TAM
TRIS(HYDROXYETHYL)AMINOMETHANE[11 atoms] |
D | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | O |
7R8
6-oxidanylnaphthalene-2-carboximidamide[14 atoms] |
B | 100.0 /100.0 |
10 /10 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | FA |
7R8
6-oxidanylnaphthalene-2-carboximidamide[14 atoms] |
D | 100.0 /100.0 |
10 /10 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
7xyd | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7xyd | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8s0l | C |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /99.7 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8s0m | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /99.7 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8yqq | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[15 atoms].. |
B | 100.0 /99.7 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7meq | D |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
7meq | E |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | E |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | H |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | H |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | DA |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
C | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | Z |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | DA |
UNX
UNKNOWN ATOM OR ION[1 atoms] |
D | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
7xyd | F |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7xyd | I |
CA
CALCIUM ION[1 atoms] |
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | F |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0e | I |
CA
CALCIUM ION[1 atoms] |
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | F |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
7y0f | I |
CA
CALCIUM ION[1 atoms] |
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | E |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8hd8 | H |
CA
CALCIUM ION[1 atoms] |
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8s0l | D |
CA
CALCIUM ION[1 atoms] |
A | 100.0 /99.7 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | J |
CA
CALCIUM ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8v04 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
7meq | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8vgt | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /99.4 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8y8b | C | TMPS2_HUMAN Transmembrane protease serine 2[47 aa] | D | 100.0 /100.0 |
18 /18 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | F | TMPS2_HUMAN Transmembrane protease serine 2[345 aa] | D | 100.0 /99.7 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | F | TMPS2_HUMAN Transmembrane protease serine 2[345 aa] | E | 100.0 /99.7 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | D | TMPS2_HUMAN Transmembrane protease serine 2[345 aa] | F | 100.0 /99.7 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8y1e | E | TMPS2_HUMAN Transmembrane protease serine 2[345 aa] | F | 100.0 /99.7 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
492 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7y0e | K |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /100.0 |
12 /12 |
TMPS2_HUMAN Transmembrane protease serine 2 catalytic chain | |
8v04 | D |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v04 | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v04 | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v04 | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v04 | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | O |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | P |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | I |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | K |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | L |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | M |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | Q |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | R |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | S |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | T |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | U |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | V |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | W |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | AA |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | AA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | GA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | HA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | IA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
5 /5 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | KA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | LA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | MA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | NA |
EDO
1,2-ETHANEDIOL[4 atoms] |
D | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | I |
CIT
CITRIC ACID[13 atoms] |
B | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | CA |
CIT
CITRIC ACID[13 atoms] |
C | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | Y |
CIT
CITRIC ACID[13 atoms] |
C | 100.0 /100.0 |
3 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | CA |
CIT
CITRIC ACID[13 atoms] |
D | 100.0 /100.0 |
4 /4 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v04 | N |
PG4
TETRAETHYLENE GLYCOL[13 atoms] |
B | 100.0 /100.0 |
7 /7 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | BA |
PG4
TETRAETHYLENE GLYCOL[13 atoms] |
C | 100.0 /100.0 |
6 /6 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
8v1f | BA |
PG4
TETRAETHYLENE GLYCOL[13 atoms] |
D | 100.0 /100.0 |
2 /2 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | JA |
PG4
TETRAETHYLENE GLYCOL[13 atoms] |
D | 100.0 /100.0 |
11 /11 |
TMPS2_HUMAN Transmembrane protease serine 2 | |
8v1f | X |
PEG
DI(HYDROXYETHYL)ETHER[7 atoms] |
C | 100.0 /100.0 |
3 /3 |
TMPS2_HUMAN Transmembrane protease serine 2 non-catalytic chai.. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |