Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
12250 | 222 | 6 | P0DTC5(VME1_SARS2) | RecName: Full=Membrane protein ; Short=M;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ; |
QUERYSEQ |
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ |
222 | region | name | description |
1-222 | CHAIN | /note="Membrane protein" /id="PRO_0000449652" | |
2-19 | TOPO_DOM | /note="Virion surface" | |
20-40 | TRANSMEM | /note="Helical" | |
41-50 | TOPO_DOM | /note="Intravirion" | |
51-71 | TRANSMEM | /note="Helical" | |
72-79 | TOPO_DOM | /note="Virion surface" | |
80-100 | TRANSMEM | /note="Helical" | |
101-222 | TOPO_DOM | /note="Intravirion" | |
1-219 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
222 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7vgr | E | 100.0 | VME1_SARS2 Membrane protein | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
222 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr[2] | A | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgr[2] | C | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgr[2] | B | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgr[2] | D | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein | |
7vgs[2] | B | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
7vgs[2] | E | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein | |
7vgs[2] | C | YN7717_9 Fab heavy chain[213 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
222 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7vgr[4] | F | VME1_SARS2 Membrane protein[198 aa] | E | 100.0 /100.0 |
46 /46 |
VME1_SARS2 Membrane protein | |
8ctk[2] | B | VME1_SARS2 Membrane protein[188 aa] | A | 100.0 /100.0 |
36 /36 |
VME1_SARS2 Membrane protein | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |