Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
12250 | 222 | 12 | P0DTC5(VME1_SARS2) | RecName: Full=Membrane protein ; Short=M;AltName: Full=E1 glycoprotein ;AltName: Full=Matrix glycoprotein ;AltName: Full=Membrane glycoprotein ; |
QUERYSEQ |
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLR IAGHHLGRCDIKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ |
222 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-222 | CHAIN | /note="Membrane protein" /id="PRO_0000449652" |
![]() ![]() ![]() |
2-19 | TOPO_DOM | /note="Virion surface" |
![]() ![]() ![]() |
20-40 | TRANSMEM | /note="Helical" |
![]() ![]() ![]() |
41-50 | TOPO_DOM | /note="Intravirion" |
![]() ![]() ![]() |
51-71 | TRANSMEM | /note="Helical" |
![]() ![]() ![]() |
72-79 | TOPO_DOM | /note="Virion surface" |
![]() ![]() ![]() |
80-100 | TRANSMEM | /note="Helical" |
![]() ![]() |
101-222 | TOPO_DOM | /note="Intravirion" |
![]() ![]() ![]() ![]() ![]() ![]() |
1-219 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
222 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | VME1_SARS2 Membrane protein | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
222 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | YN7756_1 Fab light chain[218 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | YN7756_1 Fab heavy chain[220 aa] | E | 100.0 /100.0 |
4 /4 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() |
![]() |
E | YN7717_9 Fab light chain[218 aa] | A | 100.0 /100.0 |
3 /3 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | YN7717_9 Fab heavy chain[213 aa] | A | 100.0 /100.0 |
9 /9 |
VME1_SARS2 Membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
222 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
N8E
|
A | 25.0 /46.2 |
4 /4 |
VME1_BCHK5 Membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
222 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | VME1_SARS2 Membrane protein[198 aa] | E | 100.0 /100.0 |
46 /46 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | VME1_SARS2 Membrane protein[188 aa] | A | 100.0 /100.0 |
36 /36 |
VME1_SARS2 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | VME1_BCHK5 Membrane protein[187 aa] | A | 45.6 /46.2 |
57 /58 |
VME1_BCHK5 Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 53.3 /44.0 |
30 /38 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | A | 18.2 /44.0 |
11 /11 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein[313 aa].. | B | 43.9 /44.2 |
41 /41 |
GFP_AEQVI VME1_BCHK5 GFP_AEQVI Green fluorescent protein,Membrane protein |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |