Contact Molecules for Homologous Proteins


[Full Bars]

[SiteTable]


Summary Bars[70 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2993159 296 26 Q99836(MYD88_HUMAN) RecName: Full=Myeloid differentiation primary response protein MyD88 ;
QUERYSEQ
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL
DDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q99836(MYD88_HUMAN)]

296
region name description
1-296 CHAIN /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666"
54-109 DOMAIN /note="Death"
159-293 DOMAIN /note="TIR"
110-155 REGION /note="Intermediate domain"
1-16 DISORDER predicted by DISOPRED

MONOMER
296
pdb_id a1 identity[%]2 description
2js7 A 100.0 MYD88_HUMAN Myeloid differentiation primary response protein MyD88
6i3n M 100.0 H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3mop[4] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. C 100.0
/100.0
9
/9
MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[3] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. D 100.0
/100.0
6
/6
MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[1] G IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. F 100.0
/100.0
7
/7
MYD88_HUMAN Myeloid differentiation primary response protein M..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4eo7[1] B MG
MAGNESIUM ION[1 atoms]
A 100.0
/100.0
2
/2
MYD88_HUMAN Myeloid differentiation primary response protein M..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
296 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3mop[5] B MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0
5
/5
MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[63] D MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0
12
/12
MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[2] E MYD88_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0
11
/11
MYD88_HUMAN Myeloid differentiation primary response protein M..
3mop[3] A MYD88_HUMAN Myeloid differentiation primary response protein M.. D 100.0
/100.0
10
/10
MYD88_HUMAN Myeloid differentiation primary response protein M..
6i3n[9] B H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. A 100.0
/100.0
9
/9
H0Y4G9_HUMAN Myeloid differentiation primary response protein M..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.