Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2993159 | 296 | 62 | Q99836(MYD88_HUMAN) | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
QUERYSEQ |
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL DDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP |
296 | region | name | description |
1-296 | CHAIN | /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" | |
54-109 | DOMAIN | /note="Death" | |
159-293 | DOMAIN | /note="TIR" | |
110-155 | REGION | /note="Intermediate domain" | |
1-16 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
296 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2js7 | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | M | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3mop[4] | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | C | 100.0 /100.0 |
9 /9 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop[3] | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | D | 100.0 /100.0 |
6 /6 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop[1] | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | F | 100.0 /100.0 |
7 /7 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
4w8h[1] | B | hexa-His tag[4 aa] | A | 50.0 /33.1 |
4 /5 |
A6M946_HYDVU Toll-receptor-related 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4eo7[1] | B |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
4w8h[1] | C |
CL
CHLORIDE ION[1 atoms] |
A | 50.0 /33.1 |
2 /2 |
A6M946_HYDVU Toll-receptor-related 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3mop[5] | B | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
5 /5 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop[63] | D | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
12 /12 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop[2] | E | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
11 /11 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop[3] | A | MYD88_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
10 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n[9] | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
4om7[2] | B | TLR6_HUMAN Toll-like receptor 6[143 aa] | A | 25.0 /30.8 |
8 /12 |
TLR6_HUMAN Toll-like receptor 6 | |
1fyw[4] | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] | A | 26.7 /31.0 |
15 /16 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1o77[4] | B | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] | A | 8.3 /29.1 |
12 /14 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1o77[4] | C | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[135 aa] | A | 40.0 /29.1 |
5 /6 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
5uzb[19] | B | TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | A | 50.0 /28.4 |
6 /6 |
TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | |
5uzb[8] | H | TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | A | 0.0 /28.4 |
2 /3 |
TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | |
5uzb[8] | J | TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | A | 25.0 /28.4 |
4 /4 |
TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | |
5uzb[8] | M | TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | A | 30.0 /28.4 |
10 /10 |
TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | |
5uzb[11] | N | TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | A | 0.0 /28.4 |
8 /8 |
TIRAP_HUMAN Toll/interleukin-1 receptor domain-containing adap.. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |