Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2993159 | 296 | 43 | Q99836(MYD88_HUMAN) | RecName: Full=Myeloid differentiation primary response protein MyD88 ; |
QUERYSEQ |
MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL DDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP |
296 | region | name | description |
1-296 | CHAIN | /note="Myeloid differentiation primary response protein MyD88" /id="PRO_0000096666" | |
54-109 | DOMAIN | /note="Death" | |
159-293 | DOMAIN | /note="TIR" | |
110-155 | REGION | /note="Intermediate domain" | |
1-16 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
296 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
2js7 | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
2z5v | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
4eo7 | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
7l6w | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
7beq | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
7ber | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
4dom | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | M | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | L | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | K | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | J | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | I | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | H | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | G | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | F | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | E | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | D | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | C | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | B | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
6i3n | A | 100.0 | H0Y4G9_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | A | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | B | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | F | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | E | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | D | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
3mop | C | 100.0 | MYD88_HUMAN Myeloid differentiation primary response protein MyD88 | ||||
7fcc | A | 30.8 | IL1AP_HUMAN Isoform 4 of Interleukin-1 receptor accessory protein | ||||
4w8h | A | 33.1 | A6M946_HYDVU Toll-receptor-related 2 | ||||
4w8g | A | 33.1 | A6M946_HYDVU Toll-receptor-related 2 | ||||
1o77 | E | 31.7 | TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | ||||
1fyw | A | 31.0 | TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | ||||
1o77 | B | 32.0 | TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | ||||
7fcj | A | 35.7 | K9K3G6_DANRE SIGIRR protein | ||||
1fyx | A | 30.2 | TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | ||||
7fcl | B | 34.3 | K9K3G6_DANRE SIGIRR protein | ||||
7fcl | A | 34.3 | K9K3G6_DANRE SIGIRR protein | ||||
7fcl | C | 34.3 | K9K3G6_DANRE SIGIRR protein | ||||
4om7 | A | 30.8 | TLR6_HUMAN Toll-like receptor 6 | ||||
4om7 | B | 30.8 | TLR6_HUMAN Toll-like receptor 6 | ||||
7nuw | A | 30.8 | TLR1_HUMAN Toll-like receptor 1 | ||||
7nt7 | A | 30.8 | TLR1_HUMAN Toll-like receptor 1 | ||||
7nux | A | 30.8 | TLR1_HUMAN Toll-like receptor 1 | ||||
1fyv | A | 30.8 | TLR1_HUMAN TOLL-LIKE RECEPTOR 1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3mop | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | C | 100.0 /100.0 |
9 /9 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | D | 100.0 /100.0 |
6 /6 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | H | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | D | 100.0 /100.0 |
10 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | H | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | E | 100.0 /100.0 |
7 /7 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | I | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | E | 100.0 /100.0 |
11 /11 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | G | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | F | 100.0 /100.0 |
7 /7 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | I | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | F | 100.0 /100.0 |
6 /6 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | J | IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4[107 aa].. | F | 100.0 /100.0 |
10 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
4w8h | B | hexa-His tag[4 aa] | A | 50.0 /33.1 |
4 /5 |
A6M946_HYDVU Toll-receptor-related 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4eo7 | B |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
4w8h | C |
CL
CHLORIDE ION[1 atoms] |
A | 50.0 /33.1 |
2 /2 |
A6M946_HYDVU Toll-receptor-related 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
296 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3mop | B | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
5 /5 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | D | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
12 /12 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | E | MYD88_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
11 /11 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | A | MYD88_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
5 /5 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | C | MYD88_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
6 /6 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | E | MYD88_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
12 /12 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | F | MYD88_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
11 /11 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | B | MYD88_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
4 /4 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | D | MYD88_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
6 /6 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | F | MYD88_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
10 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | A | MYD88_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
10 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | C | MYD88_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
5 /5 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | E | MYD88_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
4 /4 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | A | MYD88_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
10 /11 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | B | MYD88_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
13 /13 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | D | MYD88_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
3 /3 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | F | MYD88_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
4 /4 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | B | MYD88_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
9 /10 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | C | MYD88_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
9 /9 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
3mop | E | MYD88_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
3 /3 |
MYD88_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | C | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | F | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | A | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | A | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | C | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | F | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | B | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | A | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | D | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | C | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | C | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | F | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | D | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | D | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | F | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | J | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
10 /10 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | E | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | A | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | D | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | F | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | G | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | I | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | G | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | K | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | G | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | G | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
10 /10 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | C | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | G | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | I | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | H | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | G | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | I | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | I | 100.0 /100.0 |
10 /10 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | J | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | I | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | I | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | J | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | I | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | J | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | K | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | J | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | J | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | M | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | J | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | G | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | K | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | J | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | K | 100.0 /100.0 |
10 /10 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | L | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | K | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | B | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
11 /11 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | G | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | J | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | K | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | L | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | C | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | D | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
8 /8 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | E | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | H | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
4 /4 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | I | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
9 /9 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
6i3n | J | H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | M | 100.0 /100.0 |
12 /12 |
H0Y4G9_HUMAN Myeloid differentiation primary response protein M.. | |
1o77 | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[141 aa] | B | 27.3 /32.0 |
11 /12 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1o77 | D | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[141 aa] | B | 0.0 /32.0 |
1 /5 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
4om7 | B | TLR6_HUMAN Toll-like receptor 6[143 aa] | A | 25.0 /30.8 |
8 /12 |
TLR6_HUMAN Toll-like receptor 6 | |
4om7 | A | TLR6_HUMAN Toll-like receptor 6[143 aa] | B | 28.6 /30.8 |
7 /12 |
TLR6_HUMAN Toll-like receptor 6 | |
1fyw | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] | A | 26.7 /31.0 |
15 /16 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1fyw | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] | A | 26.7 /31.0 |
15 /16 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1fyx | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] | A | 25.0 /30.2 |
16 /17 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
1fyx | A | TLR2_HUMAN TOLL-LIKE RECEPTOR 2[149 aa] | A | 25.0 /30.2 |
16 /17 |
TLR2_HUMAN TOLL-LIKE RECEPTOR 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |