Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2908540 | 258 | 14 | O95721(SNP29_HUMAN) | RecName: Full=Synaptosomal-associated protein 29 ; Short=SNAP-29 ;AltName: Full=Soluble 29 kDa NSF attachment protein ;AltName: Full=Vesicle-membrane fusion protein SNAP-29; |
QUERYSEQ |
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAI STSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL |
258 | region | name | description |
1-258 | CHAIN | /note="Synaptosomal-associated protein 29" /id="PRO_0000213601" | |
196-258 | DOMAIN | /note="t-SNARE coiled-coil homology" | |
1-41 | REGION | /note="Disordered" | |
150-191 | REGION | /note="Disordered" | |
76-107 | COILED | ||
10-36 | COMPBIAS | /note="Basic and acidic residues" | |
161-175 | COMPBIAS | /note="Basic and acidic residues" | |
1-258 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
258 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
4wy4 | C | 100.0 | SNP29_HUMAN Synaptosomal-associated protein 29 | ||||
7bv6 | H | 100.0 | SNP29_HUMAN Synaptosomal-associated protein 29 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
258 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
4wy4[1] | A | VAMP8_HUMAN Vesicle-associated membrane protein 8[64 aa] | C | 100.0 /100.0 |
3 /3 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
4wy4[7] | A | VAMP8_HUMAN Vesicle-associated membrane protein 8[64 aa] | D | 100.0 /100.0 |
24 /24 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
7bv6[6] | A | VAMP8_HUMAN Vesicle-associated membrane protein 8[66 aa] | C | 100.0 /100.0 |
4 /4 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
4wy4[7] | B | STX17_HUMAN Syntaxin-17[58 aa] | C | 100.0 /100.0 |
25 /25 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
4wy4[1] | B | STX17_HUMAN Syntaxin-17[58 aa] | D | 100.0 /100.0 |
5 /5 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
7bv6[6] | B | STX17_HUMAN Syntaxin-17[61 aa] | D | 100.0 /100.0 |
5 /5 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
4wy4[7] | D | SNP29_HUMAN Synaptosomal-associated protein 29[65 aa] | C | 100.0 /100.0 |
28 /28 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
4wy4[7] | C | SNP29_HUMAN Synaptosomal-associated protein 29[78 aa] | D | 100.0 /100.0 |
27 /27 |
SNP29_HUMAN Synaptosomal-associated protein 29 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |