Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2711687 | 385 | 29 | P35613(BASI_HUMAN) | RecName: Full=Basigin ;AltName: Full=5F7;AltName: Full=Collagenase stimulatory factor;AltName: Full=Extracellular matrix metalloproteinase inducer; Short=EMMPRIN;AltName: Full=Hepatoma-associated antigen ; Short=HAb18G ;AltName: Full=Leukocyte activation antigen M6;AltName: Full=OK blood group antigen;AltName: Full=Tumor cell-derived collagenase stimulatory factor; Short=TCSF;AltName: CD_antigen=CD147;Flags: Precursor; |
QUERYSEQ |
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS |
385 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() |
1-21 | SIGNAL | |
![]() ![]() |
22-385 | CHAIN | /note="Basigin" /id="PRO_0000014518" |
![]() ![]() ![]() |
138-323 | TOPO_DOM | /note="Extracellular" |
![]() ![]() ![]() |
324-344 | TRANSMEM | /note="Helical" |
![]() ![]() |
345-385 | TOPO_DOM | /note="Cytoplasmic" |
![]() ![]() ![]() |
37-120 | DOMAIN | /note="Ig-like" |
![]() ![]() ![]() |
138-219 | DOMAIN | /note="Ig-like C2-type" |
![]() ![]() ![]() |
221-315 | DOMAIN | /note="Ig-like V-type" |
![]() ![]() |
353-385 | REGION | /note="Disordered" |
![]() |
356132195-199 | REGION | /note="Essential for interaction with KDR/VEGFR2" |
![]() ![]() ![]() ![]() ![]() |
1-385 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
385 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | BASI_HUMAN Basigin | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 99.1 | BASI_HUMAN Basigin | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
385 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | B2L3N7_PLAFA Reticulocyte binding protein 5[286 aa] | B | 100.0 /100.0 |
24 /25 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | B2L3N7_PLAFA Reticulocyte binding protein 5[285 aa] | D | 100.0 /100.0 |
20 /21 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 6H8 Fab fragment heavy chain[215 aa] | E | 100.0 /100.0 |
9 /9 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 6H8 Fab fragment light chain[213 aa] | E | 100.0 /100.0 |
7 /7 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | MOT1_HUMAN Monocarboxylate transporter 1[382 aa] | B | 100.0 /100.0 |
10 /10 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | heavy chain[212 aa] | A | 100.0 /100.0 |
15 /15 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | light chain[214 aa] | A | 100.0 /100.0 |
8 /8 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Light chain of antibody Fab fragment[217 aa] | A | 100.0 /98.8 |
14 /14 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Heavy chain of antibody Fab fragment[212 aa] | A | 100.0 /98.8 |
7 /7 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | XKR8_HUMAN XK-related protein 8[355 aa] | A | 100.0 /98.5 |
12 /12 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Heavy chain of 6E7F1[214 aa] | A | 40.0 /50.0 |
10 /11 |
BASI_MOUSE Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Light chain of 6E7F1[213 aa] | A | 22.2 /50.0 |
9 /10 |
BASI_MOUSE Isoform 2 of Basigin |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
385 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
D |
CD
|
A | 100.0 /98.8 |
1 /1 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() |
![]() |
E |
CD
|
A | 100.0 /98.8 |
1 /1 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() |
![]() |
F |
CD
|
A | 100.0 /98.8 |
1 /1 |
BASI_HUMAN Isoform 2 of Basigin |
![]() ![]() ![]() ![]() ![]() |
![]() |
C |
CL
|
B | 100.0 /98.7 |
1 /1 |
Q54A51_HUMAN Cervical EMMPRIN |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
385 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | BASI_HUMAN Basigin[116 aa] | A | 100.0 /98.3 |
14 /15 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | BASI_HUMAN Basigin[117 aa] | A | 100.0 /99.1 |
1 /1 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | BASI_HUMAN Basigin[116 aa] | A | 100.0 /99.1 |
7 /7 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | BASI_HUMAN Basigin[116 aa] | B | 100.0 /99.1 |
7 /7 |
BASI_HUMAN Basigin |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Q54A51_HUMAN Cervical EMMPRIN[79 aa] | A | 100.0 /98.7 |
7 /7 |
Q54A51_HUMAN Cervical EMMPRIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Q54A51_HUMAN Cervical EMMPRIN[85 aa] | A | 100.0 /98.7 |
36 /36 |
Q54A51_HUMAN Cervical EMMPRIN |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
385 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
E |
ACT
|
D | 100.0 /100.0 |
2 /2 |
Q54A51_HUMAN Cervical EMMPRIN |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |