Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[100 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2711687 385 16 P35613(BASI_HUMAN) RecName: Full=Basigin ;AltName: Full=5F7;AltName: Full=Collagenase stimulatory factor;AltName: Full=Extracellular matrix metalloproteinase inducer; Short=EMMPRIN;AltName: Full=Hepatoma-associated antigen ; Short=HAb18G ;AltName: Full=Leukocyte activation antigen M6;AltName: Full=OK blood group antigen;AltName: Full=Tumor cell-derived collagenase stimulatory factor; Short=TCSF;AltName: CD_antigen=CD147;Flags: Precursor;
QUERYSEQ 
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG
SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P35613(BASI_HUMAN)]

385
region name description
1-21 SIGNAL
22-385 CHAIN /note="Basigin" /id="PRO_0000014518"
138-323 TOPO_DOM /note="Extracellular"
324-344 TRANSMEM /note="Helical"
345-385 TOPO_DOM /note="Cytoplasmic"
37-120 DOMAIN /note="Ig-like"
138-219 DOMAIN /note="Ig-like C2-type"
221-315 DOMAIN /note="Ig-like V-type"
353-385 REGION /note="Disordered"
356132195-199 REGION /note="Essential for interaction with KDR/VEGFR2"
1-385 DISORDER predicted by DISOPRED

MONOMER
385
pdb_id a1 identity[%]2 description
7da5 B 100.0 BASI_HUMAN Basigin
7cko B 100.0 BASI_HUMAN Basigin
6lz0 B 100.0 BASI_HUMAN Basigin
6lyy B 100.0 BASI_HUMAN Basigin
7ckr B 100.0 BASI_HUMAN Basigin
3b5h B 100.0 Q54A51_HUMAN Cervical EMMPRIN
3b5h A 100.0 Q54A51_HUMAN Cervical EMMPRIN
7xy8 A 100.0 BASI_HUMAN Isoform 2 of Basigin
3b5h C 100.0 Q54A51_HUMAN Cervical EMMPRIN
4u0q B 100.0 BASI_HUMAN Basigin
4u0q D 100.0 BASI_HUMAN Basigin
3b5h D 100.0 Q54A51_HUMAN Cervical EMMPRIN
5xf0 A 100.0 BASI_HUMAN Basigin
7xy8 B 100.0 BASI_HUMAN Isoform 2 of Basigin
5x0t F 100.0 BASI_HUMAN Basigin
5x0t E 100.0 BASI_HUMAN Basigin 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
4u0q A B2L3N7_PLAFA Reticulocyte binding protein 5[286 aa] B 100.0
/100.0		 24
/25		 BASI_HUMAN Basigin
4u0q C B2L3N7_PLAFA Reticulocyte binding protein 5[285 aa] D 100.0
/100.0		 20
/21		 BASI_HUMAN Basigin
5x0t A 6H8 Fab fragment heavy chain[215 aa] E 100.0
/100.0		 9
/9		 BASI_HUMAN Basigin
5x0t B 6H8 Fab fragment heavy chain[215 aa] F 100.0
/100.0		 9
/9		 BASI_HUMAN Basigin
5x0t C 6H8 Fab fragment light chain[213 aa] E 100.0
/100.0		 7
/7		 BASI_HUMAN Basigin
5x0t D 6H8 Fab fragment light chain[213 aa] F 100.0
/100.0		 7
/7		 BASI_HUMAN Basigin
6lyy A MOT1_HUMAN Monocarboxylate transporter 1[382 aa] B 100.0
/100.0		 10
/10		 BASI_HUMAN Basigin
6lz0 A MOT1_HUMAN Monocarboxylate transporter 1[375 aa] B 100.0
/100.0		 13
/13		 BASI_HUMAN Basigin
7cko A MOT1_HUMAN Monocarboxylate transporter 1[375 aa] B 100.0
/100.0		 11
/11		 BASI_HUMAN Basigin
7ckr A MOT1_HUMAN Monocarboxylate transporter 1[382 aa] B 100.0
/100.0		 12
/12		 BASI_HUMAN Basigin
7da5 A MOT1_HUMAN Monocarboxylate transporter 1[375 aa] B 100.0
/100.0		 10
/10		 BASI_HUMAN Basigin
7xy8 C heavy chain[212 aa] A 100.0
/100.0		 15
/15		 BASI_HUMAN Isoform 2 of Basigin
7xy8 D heavy chain[218 aa] B 100.0
/100.0		 12
/12		 BASI_HUMAN Isoform 2 of Basigin
7xy8 E light chain[214 aa] A 100.0
/100.0		 8
/8		 BASI_HUMAN Isoform 2 of Basigin
7xy8 F light chain[214 aa] B 100.0
/100.0		 5
/5		 BASI_HUMAN Isoform 2 of Basigin
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
385 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3b5h E ACT
ACETATE ION[4 atoms] 		D 100.0
/100.0		 2
/2		 Q54A51_HUMAN Cervical EMMPRIN
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.