Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2676554 | 163 | 19 | Q96PD4(IL17F_HUMAN) | RecName: Full=Interleukin-17F; Short=IL-17F;AltName: Full=Cytokine ML-1;Flags: Precursor; |
QUERYSEQ |
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ |
163 | region | name | description |
1-30 | SIGNAL | ||
31-163 | CHAIN | /note="Interleukin-17F" /id="PRO_0000015432" | |
1-163 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
163 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
6hgo | C | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
6hgo | A | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
6hgo | B | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
1jpy | B | 100.0 | interleukin 17F | ||||
1jpy | A | 100.0 | interleukin 17F | ||||
6hgo | D | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
5n92 | B | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
1jpy | D | 100.0 | interleukin 17F | ||||
1jpy | C | 100.0 | interleukin 17F | ||||
6ppg | F | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
5nan | E | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
5nan | F | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
6hg9 | A | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
6ppg | A | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
3jvf | B | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
6hg4 | A | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
3jvf | A | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
8ruu | F | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
8ruu | C | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3jvf | C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
3jvf | C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | B | 100.0 /100.0 |
25 /25 |
IL17F_HUMAN Interleukin-17F | |
5nan | C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | E | 100.0 /100.0 |
28 /28 |
IL17F_HUMAN Interleukin-17F | |
5nan | B | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | F | 100.0 /100.0 |
27 /27 |
IL17F_HUMAN Interleukin-17F | |
5n92 | A | IL17_HUMAN Interleukin-17A[109 aa] | B | 100.0 /100.0 |
58 /58 |
IL17F_HUMAN Interleukin-17F | |
5nan | D | IL17_HUMAN Interleukin-17A[104 aa] | E | 100.0 /100.0 |
50 /50 |
IL17F_HUMAN Interleukin-17F | |
5nan | A | IL17_HUMAN Interleukin-17A[100 aa] | F | 100.0 /100.0 |
46 /46 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
21 /21 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
21 /21 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | B | I17RC_HUMAN Interleukin-17 receptor C[423 aa] | A | 100.0 /100.0 |
18 /18 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | B | I17RC_HUMAN Interleukin-17 receptor C[423 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | B | I17RC_HUMAN Interleukin-17 receptor C[423 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | B | I17RC_HUMAN Interleukin-17 receptor C[423 aa] | A | 100.0 /100.0 |
18 /18 |
IL17F_HUMAN Interleukin-17F | |
6ppg | B | Fab MCAF5352A light chain[212 aa] | A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | E | Fab MCAF5352A light chain[216 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F | |
6ppg | B | Fab MCAF5352A light chain[212 aa] | F | 100.0 /100.0 |
6 /6 |
IL17F_HUMAN Interleukin-17F | |
6ppg | E | Fab MCAF5352A light chain[216 aa] | F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | C | Fab MCAF5352A heavy chain[223 aa] | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6ppg | D | Fab MCAF5352A heavy chain[226 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F | |
6ppg | C | Fab MCAF5352A heavy chain[223 aa] | F | 100.0 /100.0 |
9 /9 |
IL17F_HUMAN Interleukin-17F | |
6ppg | D | Fab MCAF5352A heavy chain[226 aa] | F | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
8ruu | A | Immunoblobulin heavy chain[219 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F | |
8ruu | D | Immunoblobulin heavy chain[220 aa] | F | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F | |
8ruu | B | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F | |
8ruu | E | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
6 /6 |
IL17F_HUMAN Interleukin-17F | |
8ruu | B | Immunoblobulin light chain[213 aa] | F | 100.0 /100.0 |
4 /4 |
IL17F_HUMAN Interleukin-17F | |
8ruu | E | Immunoblobulin light chain[213 aa] | F | 100.0 /100.0 |
13 /13 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
1jpy | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
5nan | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
E | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6hgo | F |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6hgo | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6hgo | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
D | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6ppg | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg | CB |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
8ruu | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
F | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3jvf | E |
CA
CALCIUM ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg | H |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg | I |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | J |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | K |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | L |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | DB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | EB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg | FB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg | HB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg | IB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy | E | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. | B | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
1jpy | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
3 /3 |
interleukin 17F | |
3jvf | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6hgo | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
5n92 | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
5nan | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. | F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
8ruu | G | alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. | C | 100.0 /100.0 |
4 /4 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy | B | interleukin 17F[121 aa] | A | 100.0 /100.0 |
64 /64 |
interleukin 17F | |
1jpy | A | interleukin 17F[121 aa] | B | 100.0 /100.0 |
64 /64 |
interleukin 17F | |
1jpy | D | interleukin 17F[120 aa] | C | 100.0 /100.0 |
66 /66 |
interleukin 17F | |
1jpy | C | interleukin 17F[117 aa] | D | 100.0 /100.0 |
64 /64 |
interleukin 17F | |
3jvf | B | IL17F_HUMAN Interleukin-17F[104 aa] | A | 100.0 /100.0 |
38 /38 |
IL17F_HUMAN Interleukin-17F | |
3jvf | A | IL17F_HUMAN Interleukin-17F[104 aa] | B | 100.0 /100.0 |
40 /40 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | A | IL17F_HUMAN Interleukin-17F[104 aa] | A | 100.0 /100.0 |
45 /45 |
IL17F_HUMAN Interleukin-17F | |
6hg4 | A | IL17F_HUMAN Interleukin-17F[104 aa] | A | 100.0 /100.0 |
45 /45 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | A | IL17F_HUMAN Interleukin-17F[109 aa] | A | 100.0 /100.0 |
40 /40 |
IL17F_HUMAN Interleukin-17F | |
6hg9 | A | IL17F_HUMAN Interleukin-17F[109 aa] | A | 100.0 /100.0 |
40 /40 |
IL17F_HUMAN Interleukin-17F | |
6hgo | B | IL17F_HUMAN Interleukin-17F[122 aa] | A | 100.0 /100.0 |
65 /65 |
IL17F_HUMAN Interleukin-17F | |
6hgo | A | IL17F_HUMAN Interleukin-17F[126 aa] | B | 100.0 /100.0 |
65 /65 |
IL17F_HUMAN Interleukin-17F | |
6hgo | D | IL17F_HUMAN Interleukin-17F[121 aa] | C | 100.0 /100.0 |
66 /66 |
IL17F_HUMAN Interleukin-17F | |
6hgo | C | IL17F_HUMAN Interleukin-17F[127 aa] | D | 100.0 /100.0 |
65 /65 |
IL17F_HUMAN Interleukin-17F | |
6ppg | F | IL17F_HUMAN Interleukin-17F[117 aa] | A | 100.0 /100.0 |
55 /55 |
IL17F_HUMAN Interleukin-17F | |
6ppg | A | IL17F_HUMAN Interleukin-17F[109 aa] | F | 100.0 /100.0 |
51 /51 |
IL17F_HUMAN Interleukin-17F | |
8ruu | F | IL17F_HUMAN Interleukin-17F[102 aa] | C | 100.0 /100.0 |
41 /41 |
IL17F_HUMAN Interleukin-17F | |
8ruu | C | IL17F_HUMAN Interleukin-17F[97 aa] | F | 100.0 /100.0 |
41 /41 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy | H |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
6hgo | I |
SO4
SULFATE ION[5 atoms] |
D | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |