Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2634797 | 165 | 40 | P05161(ISG15_HUMAN) | RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor; |
QUERYSEQ |
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGGGTEPGGRS |
165 | region | name | description |
2-157 | CHAIN | /note="Ubiquitin-like protein ISG15" /id="PRO_0000035986" | |
158-165 | PROPEP | /note="Removed in mature form" /id="PRO_0000035987" | |
2-78 | DOMAIN | /note="Ubiquitin-like 1" | |
79-157 | DOMAIN | /note="Ubiquitin-like 2" | |
153-157 | REGION | /note="Involved in the ligation of specific target proteins" | |
1-165 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
165 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7rbs | B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
165 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3r66[8] | A | NS1_INBLE Non-structural protein 1[96 aa] | C | 100.0 /100.0 |
11 /11 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3rt3[4] | B | NS1_INBLE Non-structural protein 1[94 aa] | A | 87.5 /99.3 |
8 /8 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
5tl6[2] | B | R1AB_CVHSA Replicase polyprotein 1ab[312 aa] | C | 100.0 /100.0 |
12 /13 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6ffa[1] | A | POLG_FMDVO Lbpro[156 aa] | B | 100.0 /100.0 |
9 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6xa9[3] | A | R1AB_SARS2 Non-structural protein 3[313 aa] | B | 100.0 /100.0 |
11 /12 |
ISG15_HUMAN ISG15 CTD-propargylamide | |
7rbs[5] | A | R1A_SARS2 Papain-like protease[312 aa] | B | 100.0 /100.0 |
22 /23 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
8oif[1] | A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[704 aa.. | B | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
8se9[7] | A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. | B | 100.0 /100.0 |
26 /26 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
8se9[3] | C | UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] | D | 100.0 /100.0 |
3 /3 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
5w8t[4] | B | K0BWD0_9BETC ORF1ab[319 aa] | A | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[2] | A | K4LC41_9BETC ORF1a[259 aa] | C | 100.0 /99.3 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3phx[1] | A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
19 /19 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3phx[1] | A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3pse[1] | A | Q6TQF5_9VIRU RNA polymerase[164 aa] | B | 100.0 /98.7 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
165 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8oif[5] | D |
AMP
ADENOSINE MONOPHOSPHATE[23 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3rt3[2] | C |
SIN
SUCCINIC ACID[8 atoms] |
A | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3rt3[2] | D |
SIN
SUCCINIC ACID[8 atoms] |
A | 100.0 /99.3 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
165 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3phx[1] | H |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3phx[4] | N |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3phx[2] | P |
ZN
ZINC ION[1 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
1z2m[1] | B |
OS4
OSMIUM 4+ ION[1 atoms] |
A | 100.0 /99.3 |
3 /3 |
UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K.. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
165 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3phx[2] | M |
NEH
ETHANAMINE[3 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3phx[2] | Q |
ACY
ACETIC ACID[4 atoms] |
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3pse[1] | D |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /98.7 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[1] | G |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[2] | H |
GOL
GLYCEROL[6 atoms] |
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[1] | O |
GOL
GLYCEROL[6 atoms] |
D | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6ffa[1] | J |
GOL
GLYCEROL[6 atoms] |
B | 100.0 /100.0 |
5 /5 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
5w8t[4] | K |
MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] |
A | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
5w8t[1] | O |
MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] |
C | 100.0 /100.0 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
5w8t[4] | E |
AYE
prop-2-en-1-amine[4 atoms] |
A | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[2] | I |
AYE
prop-2-en-1-amine[4 atoms] |
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
6bi8[2] | T |
PGE
TRIETHYLENE GLYCOL[10 atoms] |
C | 100.0 /99.3 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3pse[1] | C |
4LJ
1.7.6 3-bromanylpropan-1-amine[4 atoms] |
B | 100.0 /98.7 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |