Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2634797 | 165 | 46 | P05161(ISG15_HUMAN) | RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor; |
QUERYSEQ |
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM NLRLRGGGTEPGGRS |
165 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() |
2-157 | CHAIN | /note="Ubiquitin-like protein ISG15" /id="PRO_0000035986" |
![]() ![]() |
158-165 | PROPEP | /note="Removed in mature form" /id="PRO_0000035987" |
![]() ![]() ![]() |
2-78 | DOMAIN | /note="Ubiquitin-like 1" |
![]() ![]() ![]() |
79-157 | DOMAIN | /note="Ubiquitin-like 2" |
![]() ![]() ![]() |
153-157 | REGION | /note="Involved in the ligation of specific target proteins" |
![]() ![]() ![]() |
1-165 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
165 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | ISG15_HUMAN Ubiquitin-like protein ISG15 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_CVHSA Replicase polyprotein 1ab[312 aa] | C | 100.0 /100.0 |
12 /13 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | POLG_FMDVO Lbpro[156 aa] | B | 100.0 /100.0 |
9 /10 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 3[313 aa] | B | 100.0 /100.0 |
11 /12 |
ISG15_HUMAN ISG15 CTD-propargylamide |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1A_SARS2 Papain-like protease[312 aa] | B | 100.0 /100.0 |
22 /23 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[704 aa.. | B | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. | B | 100.0 /100.0 |
26 /26 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] | D | 100.0 /100.0 |
3 /3 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | K0BWD0_9BETC ORF1ab[319 aa] | A | 100.0 /100.0 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | K4LC41_9BETC ORF1a[259 aa] | C | 100.0 /99.3 |
17 /17 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
19 /19 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | L_CCHFI RNA-directed RNA polymerase L[162 aa] | B | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Q6TQF5_9VIRU RNA polymerase[164 aa] | B | 100.0 /98.7 |
15 /15 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | B8PWH5_9VIRU RNA-dependent RNA polymerase[158 aa] | B | 78.9 /73.3 |
19 /19 |
Q9GKP4_SHEEP Interferon stimulated gene 17 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | NS1_INBLE Non-structural protein 1[96 aa] | C | 100.0 /100.0 |
11 /11 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | NS1_INBLE Non-structural protein 1[94 aa] | A | 87.5 /99.3 |
8 /8 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
D |
AMP
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SIN
|
A | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
SIN
|
A | 100.0 /99.3 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
N |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
P |
ZN
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
OS4
|
A | 100.0 /99.3 |
3 /3 |
UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K.. |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
165 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() |
![]() |
M |
NEH
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
Q |
ACY
|
B | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
GOL
|
B | 100.0 /98.7 |
7 /7 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
GOL
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() |
![]() |
H |
GOL
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
GOL
|
D | 100.0 /99.3 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
GOL
|
B | 100.0 /100.0 |
5 /5 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
MPD
|
A | 100.0 /100.0 |
2 /2 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
MPD
|
C | 100.0 /100.0 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
PGE
|
C | 100.0 /99.3 |
4 /4 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
C |
4LJ
|
B | 100.0 /98.7 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
E |
AYE
|
A | 100.0 /100.0 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
![]() ![]() ![]() ![]() |
![]() |
I |
AYE
|
C | 100.0 /99.3 |
1 /1 |
ISG15_HUMAN Ubiquitin-like protein ISG15 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |