Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[90 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2634797 165 40 P05161(ISG15_HUMAN) RecName: Full=Ubiquitin-like protein ISG15;AltName: Full=Interferon-induced 15 kDa protein;AltName: Full=Interferon-induced 17 kDa protein; Short=IP17;AltName: Full=Ubiquitin cross-reactive protein; Short=hUCRP;Flags: Precursor;
QUERYSEQ 
MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFM
NLRLRGGGTEPGGRS
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [P05161(ISG15_HUMAN)]

165
region name description
2-157 CHAIN /note="Ubiquitin-like protein ISG15" /id="PRO_0000035986"
158-165 PROPEP /note="Removed in mature form" /id="PRO_0000035987"
2-78 DOMAIN /note="Ubiquitin-like 1"
79-157 DOMAIN /note="Ubiquitin-like 2"
153-157 REGION /note="Involved in the ligation of specific target proteins"
1-165 DISORDER predicted by DISOPRED

MONOMER
165
pdb_id a1 identity[%]2 description
7rbs B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs J 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs H 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs F 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 A 99.3 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p E 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p C 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p A 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 D 99.3 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 C 99.3 ISG15_HUMAN Ubiquitin-like protein ISG15
1z2m A 99.3 UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K)
3sdl C 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3sdl D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
7s6p F 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3r66 D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3r66 C 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse B 98.7 ISG15_HUMAN Ubiquitin-like protein ISG15
8seb B 98.8 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
6xa9 B 100.0 ISG15_HUMAN ISG15 CTD-propargylamide
6xa9 F 100.0 ISG15_HUMAN ISG15 CTD-propargylamide
6xa9 D 100.0 ISG15_HUMAN ISG15 CTD-propargylamide
8sea B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
8oif B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
8sv8 B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5tl6 C 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t C 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t A 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
5tl6 D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
6ffa B 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
2hj8 A 100.0 UCRP_HUMAN Interferon-induced 17 kDa protein
8sv8 D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
8sea D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 D 100.0 ISG15_HUMAN Ubiquitin-like protein ISG15 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3r66 A NS1_INBLE Non-structural protein 1[96 aa] C 100.0
/100.0		 11
/11		 ISG15_HUMAN Ubiquitin-like protein ISG15
3r66 B NS1_INBLE Non-structural protein 1[96 aa] C 100.0
/100.0		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
3r66 A NS1_INBLE Non-structural protein 1[96 aa] D 100.0
/100.0		 8
/8		 ISG15_HUMAN Ubiquitin-like protein ISG15
3r66 B NS1_INBLE Non-structural protein 1[96 aa] D 100.0
/100.0		 9
/9		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 B NS1_INBLE Non-structural protein 1[94 aa] A 87.5
/99.3		 8
/8		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 B NS1_INBLE Non-structural protein 1[94 aa] A 100.0
/99.3		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 B NS1_INBLE Non-structural protein 1[94 aa] A 100.0
/99.3		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 B NS1_INBLE Non-structural protein 1[94 aa] A 87.5
/99.3		 8
/8		 ISG15_HUMAN Ubiquitin-like protein ISG15
3sdl A NS1_INBLE Non-structural protein 1[95 aa] C 100.0
/100.0		 13
/13		 ISG15_HUMAN Ubiquitin-like protein ISG15
3sdl B NS1_INBLE Non-structural protein 1[97 aa] C 100.0
/100.0		 10
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
3sdl A NS1_INBLE Non-structural protein 1[95 aa] D 100.0
/100.0		 9
/9		 ISG15_HUMAN Ubiquitin-like protein ISG15
3sdl B NS1_INBLE Non-structural protein 1[97 aa] D 100.0
/100.0		 10
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
5tl6 B R1AB_CVHSA Replicase polyprotein 1ab[312 aa] C 100.0
/100.0		 12
/13		 ISG15_HUMAN Ubiquitin-like protein ISG15
5tl6 A R1AB_CVHSA Replicase polyprotein 1ab[315 aa] D 100.0
/100.0		 9
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
6ffa A POLG_FMDVO Lbpro[156 aa] B 100.0
/100.0		 9
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
6xa9 A R1AB_SARS2 Non-structural protein 3[313 aa] B 100.0
/100.0		 11
/12		 ISG15_HUMAN ISG15 CTD-propargylamide
6xa9 C R1AB_SARS2 Non-structural protein 3[313 aa] D 100.0
/100.0		 13
/14		 ISG15_HUMAN ISG15 CTD-propargylamide
6xa9 E R1AB_SARS2 Non-structural protein 3[307 aa] F 100.0
/100.0		 12
/13		 ISG15_HUMAN ISG15 CTD-propargylamide
7rbs A R1A_SARS2 Papain-like protease[312 aa] B 100.0
/100.0		 22
/23		 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs C R1A_SARS2 Papain-like protease[313 aa] D 100.0
/100.0		 24
/24		 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs E R1A_SARS2 Papain-like protease[313 aa] F 100.0
/100.0		 24
/25		 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs G R1A_SARS2 Papain-like protease[313 aa] H 100.0
/100.0		 24
/25		 ISG15_HUMAN Ubiquitin-like protein ISG15
7rbs I R1A_SARS2 Papain-like protease[313 aa] J 100.0
/100.0		 24
/25		 ISG15_HUMAN Ubiquitin-like protein ISG15
8oif A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[704 aa.. B 100.0
/100.0		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. B 100.0
/100.0		 26
/26		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. D 100.0
/100.0		 9
/9		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sea A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. B 100.0
/100.0		 25
/25		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sea A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. D 100.0
/100.0		 12
/12		 ISG15_HUMAN Ubiquitin-like protein ISG15
8seb A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[989 aa.. B 100.0
/98.8		 20
/20		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sv8 A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. B 100.0
/100.0		 25
/25		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sv8 A UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7[992 aa.. D 100.0
/100.0		 10
/10		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 C UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] D 100.0
/100.0		 3
/3		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sea C UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] D 100.0
/100.0		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sv8 C UB2L6_HUMAN Ubiquitin/ISG15-conjugating enzyme E2 L6[152 aa] D 100.0
/100.0		 3
/3		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t B K0BWD0_9BETC ORF1ab[319 aa] A 100.0
/100.0		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t D K0BWD0_9BETC ORF1ab[319 aa] C 100.0
/100.0		 16
/16		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u A K0BWD0_9BETC ORF1ab[319 aa] B 100.0
/100.0		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u C K0BWD0_9BETC ORF1ab[319 aa] D 100.0
/100.0		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 A K4LC41_9BETC ORF1a[259 aa] C 100.0
/99.3		 17
/17		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 B K4LC41_9BETC ORF1a[259 aa] D 100.0
/99.3		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx A L_CCHFI RNA-directed RNA polymerase L[162 aa] B 100.0
/100.0		 19
/19		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx A L_CCHFI RNA-directed RNA polymerase L[162 aa] B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse A Q6TQF5_9VIRU RNA polymerase[164 aa] B 100.0
/98.7		 15
/15		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
8oif D AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
8se9 E AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sea E AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
8seb D AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/98.8		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
8sv8 E AMP
ADENOSINE MONOPHOSPHATE[23 atoms] 		B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 C SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 C SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 D SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
3rt3 D SIN
SUCCINIC ACID[8 atoms] 		A 100.0
/99.3		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3phx H ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx N ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx N ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx O ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx O ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx P ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx P ZN
ZINC ION[1 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
1z2m B OS4
OSMIUM 4+ ION[1 atoms] 		A 100.0
/99.3		 3
/3		 UCRP_HUMAN interferon, alpha-inducible protein (clone IFI-15K..
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
165 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3phx M NEH
ETHANAMINE[3 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx M NEH
ETHANAMINE[3 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx Q ACY
ACETIC ACID[4 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3phx Q ACY
ACETIC ACID[4 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse D GOL
GLYCEROL[6 atoms] 		B 100.0
/98.7		 7
/7		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 G GOL
GLYCEROL[6 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 H GOL
GLYCEROL[6 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 N GOL
GLYCEROL[6 atoms] 		D 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 O GOL
GLYCEROL[6 atoms] 		D 100.0
/99.3		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
6ffa J GOL
GLYCEROL[6 atoms] 		B 100.0
/100.0		 5
/5		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t K MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		A 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t N MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		C 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t O MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		C 100.0
/100.0		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u J MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		B 100.0
/100.0		 2
/2		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u T MPD
(4S)-2-METHYL-2,4-PENTANEDIOL[8 atoms] 		D 100.0
/100.0		 3
/3		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t E AYE
prop-2-en-1-amine[4 atoms] 		A 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8t M AYE
prop-2-en-1-amine[4 atoms] 		C 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u H AYE
prop-2-en-1-amine[4 atoms] 		B 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
5w8u P AYE
prop-2-en-1-amine[4 atoms] 		D 100.0
/100.0		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 I AYE
prop-2-en-1-amine[4 atoms] 		C 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 S AYE
prop-2-en-1-amine[4 atoms] 		D 100.0
/99.3		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 T PGE
TRIETHYLENE GLYCOL[10 atoms] 		C 100.0
/99.3		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
6bi8 J PGE
TRIETHYLENE GLYCOL[10 atoms] 		D 100.0
/99.3		 4
/4		 ISG15_HUMAN Ubiquitin-like protein ISG15
3pse C 4LJ
1.7.6 3-bromanylpropan-1-amine[4 atoms] 		B 100.0
/98.7		 1
/1		 ISG15_HUMAN Ubiquitin-like protein ISG15
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.